DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and AT2G23200

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_179901.1 Gene:AT2G23200 / 816852 AraportID:AT2G23200 Length:834 Species:Arabidopsis thaliana


Alignment Length:741 Identity:163/741 - (21%)
Similarity:261/741 - (35%) Gaps:251/741 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   363 PINSSPGILEVIEQLKF-----VPQPTSKNL----ELDAVVAKVHCKAQGTPTPQVQWVRDGE-- 416
            |.:||..::..||....     :|..:.|||    .|:....|:        ||      |.:  
plant   174 PDHSSLALINAIEVFSAPDDLEIPSASDKNLHTIYRLNVGGEKI--------TP------DNDTL 224

  Fly   417 -NTTLPDHVEVDANGTLIF-----RNVNSEHRGNY------------------TCLATNSQGQIN 457
             .|.|||      :...::     ||:||....||                  |..|.|...  |
plant   225 GRTWLPD------DDDFLYRKDSARNINSTQTPNYVGGLSSATDSTAPDFVYKTAKAMNRSS--N 281

  Fly   458 ATVAINVVVTPKFSVPPVGPIETSEQGTVVMHCQAIGDPKPTIQWDKDLKYLSENNTDRERFRFL 522
            ..|.:.:.||..|.|      :::.:..:.:|...|            |..||.:::|   |...
plant   282 EQVGMLMNVTWSFKV------KSNHRHFIRIHFSDI------------LSNLSNSDSD---FYLF 325

  Fly   523 ENG--TLEIRN--------------VQVED-EGSYGCTIG-----NSAG-LKREDVQLVVKTTGD 564
            .||  .::::.              |.|.| .|....:||     ..|| |...::..|:..:|.
plant   326 VNGYWRVDVKPSEQPRLASPFFKDVVNVSDGSGLLNISIGTKEANKDAGFLNGLEMMEVLSKSGS 390

  Fly   565 GFAPEESGGDGFLVTRAVLITMTVALAYIVLVVGLMLWCRYRRQARKARLNDLSTKEAGGDQPDV 629
            .::...|.....:...||......||.:.:|   .|::.: ||:::|.:             |:|
plant   391 DYSNRSSSRVHIITGCAVAAAAASALVFSLL---FMVFLK-RRRSKKTK-------------PEV 438

  Fly   630 AGNGKGSEQEPCLSKQHNGHSKSRSKSSGDAQKSDDTACSQQSRASKKSAHI-----YEQLALPR 689
                :|:...|.  ..|.|.|            ||:...||...:..::.|:     :..:....
plant   439 ----EGTVWSPL--PLHRGGS------------SDNRPISQYHNSPLRNLHLGLTIPFTDILSAT 485

  Fly   690 SGLSELIQIGRGEFGDVFVGKLKATLVTSPSDKDADTEKQHSNSENGSGGSGSGSTTLSTLNEKR 754
            :...|.:.||:|.||.|:    ||.|   |....|..::       |..|||.|           
plant   486 NNFDEQLLIGKGGFGYVY----KAIL---PDGTKAAIKR-------GKTGSGQG----------- 525

  Fly   755 RSKTSMDDIEEIKEEEQDQHNQSGLEQLVLVKALNKVKDEQACQEFRRQLDLLRAISHKGVVRLF 819
                                        :|              ||:.::.:|..|.|:.:|.|.
plant   526 ----------------------------IL--------------EFQTEIQVLSRIRHRHLVSLT 548

  Fly   820 GLCREKDPHYMVLEYTDWGDLKQFLLATAGKVNTATAGSSSPPPLTTSQVLAVAYQIARGMDAIY 884
            |.|.|.....:|.|:.:.|.||:.|.            .|:.|.||..|.|.:....|||:|.::
plant   549 GYCEENSEMILVYEFMEKGTLKEHLY------------GSNLPSLTWKQRLEICIGAARGLDYLH 601

  Fly   885 ----RARFTHRDLATRNCVISSEFIVKVSYPALCKDKYSREYHKHRNTLLPIRWLAPECIQEDEY 945
                .....|||:.:.|.::....|.||:...|.|.....|.:...|......:|.||.:|..:.
plant   602 SSGSEGAIIHRDVKSTNILLDEHNIAKVADFGLSKIHNQDESNISINIKGTFGYLDPEYLQTHKL 666

  Fly   946 TTKSDIFAYGVVVWE-LFNQAT---KLPHEEL-------------TNEQVVQRSQAGSLEWSVAE 993
            |.|||::|:|||:.| ||.:..   .|||||:             |.::::..|..|.:|     
plant   667 TEKSDVYAFGVVLLEVLFARPAIDPYLPHEEVNLSEWVMFCKSKGTIDEILDPSLIGQIE----- 726

  Fly   994 ATPDSLR---EILLSCWVSNPKERPS 1016
              .:||:   ||...|......||||
plant   727 --TNSLKKFMEIAEKCLKEYGDERPS 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845 3/9 (33%)
Ig 395..460 CDD:143165 18/90 (20%)
I-set 468..559 CDD:254352 20/113 (18%)
IGc2 484..549 CDD:197706 15/86 (17%)
PTK_CCK4 686..1026 CDD:133178 88/355 (25%)
STYKc 692..1020 CDD:214568 88/349 (25%)
AT2G23200NP_179901.1 Malectin_like 41..383 CDD:289580 51/251 (20%)
STKc_IRAK 494..759 CDD:270968 87/343 (25%)
TyrKc 494..758 CDD:197581 87/343 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 98 1.000 Inparanoid score I2197
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.