DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and BSG

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001719.2 Gene:BSG / 682 HGNCID:1116 Length:385 Species:Homo sapiens


Alignment Length:419 Identity:94/419 - (22%)
Similarity:130/419 - (31%) Gaps:158/419 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 YVCIATNLASGAREASPPAKLSVIYLESASVQLLGSNRNELLLKCHVEGASGDLEPLEIEWY--- 154
            :..:.|:.|||| .....|.||.......||:|            |.| |.|...| ||:|:   
Human    11 FALLGTHGASGA-AGFVQAPLSQQRWVGGSVEL------------HCE-AVGSPVP-EIQWWFEG 60

  Fly   155 --RNSEKLSTWKNVQLD---------QH---RLIIRQPGSEDDGLYRCTASNAAGRVMSKQGYVY 205
              .|......|...:||         ||   .:.|.....||.|.|.|.|||...|         
Human    61 QGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDR--------- 116

  Fly   206 QSSVKCLPRLPRRKNEKMMESWDKQTFLCRGKRGGAAGLEALPAAPEDLRIVQGPIGQSIIKEGE 270
                ..|.|.||.|       |         .|..|..|...|          |.:..::...|.
Human   117 ----NHLTRAPRVK-------W---------VRAQAVVLVLEP----------GTVFTTVEDLGS 151

  Fly   271 PTALTC-LYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDARLVLHK 334
            ...||| |.:...|:...    ||.|.|.:|::..|      ||...:...|:   :|       
Human   152 KILLTCSLNDSATEVTGH----RWLKGGVVLKEDAL------PGQKTEFKVDS---DD------- 196

  Fly   335 QNGTLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPT-SKNLEL------DA 392
                         ..|:|.|                       .|:|:|. :.|::|      .|
Human   197 -------------QWGEYSC-----------------------VFLPEPMGTANIQLHGPPRVKA 225

  Fly   393 VVAKVH----------CKAQGTPTPQVQW----VRDGENTTLPDHVE-------VDANGTLIFRN 436
            |.:..|          ||::..| |...|    :.|.|:..|.:..|       ......|...|
Human   226 VKSSEHINEGETAMLVCKSESVP-PVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIEN 289

  Fly   437 VNSE-HRGNYTCLATNSQGQINATVAINV 464
            :|.| ..|.|.|..|:|:|...|.:.:.|
Human   290 LNMEADPGQYRCNGTSSKGSDQAIITLRV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 0/5 (0%)
Ig strand B 133..137 CDD:409353 0/3 (0%)
Ig <135..197 CDD:472250 23/78 (29%)
Ig strand C 150..154 CDD:409353 2/3 (67%)
Ig strand E 171..175 CDD:409353 1/6 (17%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 19/95 (20%)
Ig strand B 272..276 CDD:409571 1/3 (33%)
Ig strand C 290..294 CDD:409571 1/3 (33%)
Ig strand E 337..341 CDD:409571 0/3 (0%)
Ig strand F 351..356 CDD:409571 2/4 (50%)
Ig 395..460 CDD:409353 21/86 (24%)
Ig strand B 395..399 CDD:409353 1/13 (8%)
Ig strand C 408..412 CDD:409353 1/7 (14%)
Ig strand E 430..434 CDD:409353 1/3 (33%)
Ig strand F 444..449 CDD:409353 2/4 (50%)
Ig strand G 457..460 CDD:409353 1/2 (50%)
I-set 468..559 CDD:400151
Ig strand B 486..490 CDD:409570
Ig strand C 499..503 CDD:409570
Ig strand E 525..529 CDD:409570
Ig strand F 539..544 CDD:409570
Ig strand G 552..555 CDD:409570
PTK_CCK4 686..1026 CDD:133178
BSGNP_001719.2 Ig0_BSG1 23..138 CDD:409534 39/157 (25%)
Ig strand A 24..28 CDD:409534 0/3 (0%)
Ig strand A' 29..35 CDD:409534 2/5 (40%)
Ig strand B 38..47 CDD:409534 5/21 (24%)
Ig strand C 52..60 CDD:409534 4/8 (50%)
Ig strand C' 65..69 CDD:409534 0/3 (0%)
Ig strand D 79..85 CDD:409534 0/5 (0%)
Ig strand E 88..97 CDD:409534 2/8 (25%)
Ig strand F 104..112 CDD:409534 4/7 (57%)
Ig strand G 128..138 CDD:409534 3/9 (33%)
Essential for interaction with KDR/VEGFR2. /evidence=ECO:0000269|PubMed:25825981 195..199 1/23 (4%)
IG_like 228..318 CDD:214653 21/90 (23%)
Ig strand B 238..242 CDD:409353 0/3 (0%)
Ig strand E 283..287 CDD:409353 1/3 (33%)
Ig strand F 298..303 CDD:409353 2/4 (50%)
Ig strand G 311..314 CDD:409353 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 353..385
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.