DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Pxdn

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001258190.1 Gene:Pxdn / 554172 RGDID:1560694 Length:1475 Species:Rattus norvegicus


Alignment Length:1014 Identity:206/1014 - (20%)
Similarity:333/1014 - (32%) Gaps:367/1014 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 AVRRTEDVGNYVCIATN----LASGAREASPPAKLSVIYLESASVQLLG-------SNRNELLLK 136
            |.||..:: |.:.:..|    :.|||.|  ....|..:||....:|.:.       ::..:|.|.
  Rat    78 AFRRLRNL-NTLLLNNNQIKKIPSGAFE--DLENLKYLYLYKNEIQSIDRQAFKGLASLEQLYLH 139

  Fly   137 CHVEGASGDLEPLEIEWYRNSEKLSTWKNVQLDQHRLIIRQPG--SEDDGLYRCTA-SNAAG--- 195
            .:      .:|.|:.|.:::..||   :.:.|..:|:....||  |:.:.:.|... |||..   
  Rat   140 FN------QIETLDPESFQHLPKL---ERLFLHNNRITHLVPGTFSQLESMKRLRLDSNALHCDC 195

  Fly   196 ---------RVMSKQGYVYQSSVKCLPRLPRRKNEKMMESWDKQTFLCRGKRGGAAGLEALPAAP 251
                     :..::.|.. |::..|  ..|||...:.:.:...:...|...|        :.:.|
  Rat   196 EILWLADLLKTYAQSGNA-QAAATC--EYPRRIQGRSVATITPEELNCERPR--------ITSEP 249

  Fly   252 EDLRIVQGPIGQSIIKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSF 316
            :|          :.:..|.....||..|     .|.:.::.|.::...|.               
  Rat   250 QD----------ADVTSGNTVYFTCRAE-----GNPKPEIIWLRNNNELS--------------- 284

  Fly   317 DSGKDALLREDARLVLHKQNGTLSFASIIASDAGQYQCQLQ-LEAHAPIN-------SSPGILEV 373
                   ::.|:||.| ..:|||...:...:|.|.|||..: :...|..:       .||.    
  Rat   285 -------MKTDSRLNL-LDDGTLMIQNTQEADEGVYQCMAKNVAGEAKTHEVTLRYLGSPA---- 337

  Fly   374 IEQLKFVPQPTSKNLELDAVVAKVHCKAQGTPTPQVQWVRDGENTTLP--DHVEVDANGTLIFRN 436
              :..||.||.:..:.:...|. :.|.|.|.|.||:.|.| |:.|.||  ..|.:..:|.|..:|
  Rat   338 --RPTFVIQPQNTEVLVGESVT-LECSATGHPLPQITWTR-GDRTPLPIDPRVNITPSGGLYIQN 398

  Fly   437 VNSEHRGNYTCLATNSQGQINATVAINVVVTPKFSVPPVGPIETSEQGTVVMHCQAIGDPKPTIQ 501
            |.....|.|||.|:||...|:||..|.|...|:|:|.|...:....| ||...|:|.|.|:|.|.
  Rat   399 VAQSDSGEYTCFASNSVDSIHATAFIIVQALPQFTVTPQSRVVIEGQ-TVDFQCEAKGYPQPVIA 462

  Fly   502 WDKDLKYLSENNTDRERFRFLENGTLEIRNVQVEDEGSYGCTIGNSAGLKR-------------- 552
            |.|....||   .|| |...|.:|||.|..|.:.|:|.|.|...|..|.::              
  Rat   463 WTKGGSQLS---VDR-RHLVLSSGTLRISGVALHDQGQYECQAVNIIGSQKVVAHLTVQPRVTPV 523

  Fly   553 -------------EDVQLVVKTTG----------DGFAPEESG-----GDGFLVTRAVLITMTVA 589
                         .:|||...:.|          ||....|||     .:|||.           
  Rat   524 FASIPSDMTVEVGTNVQLPCSSQGEPEPAITWNKDGVQVTESGKFHISPEGFLT----------- 577

  Fly   590 LAYIVLVVGLMLWCRYRRQARKARLNDLSTKEAGGDQPDVAGNGKGSEQEPCLSKQHNGH---SK 651
                                    :||:.|.:||              :..|:::...|:   |.
  Rat   578 ------------------------INDVGTADAG--------------RYECVARNTIGYASVSM 604

  Fly   652 SRSKSSGDAQKSDD--------TACSQQSRA-SKKSAHIYEQLALPRSGLSELI----------Q 697
            ..|.:..|..::.|        .|.:...|| :....|:::  :.|||. ::|:          .
  Rat   605 VLSVNVPDVSRNGDPYVATSIVEAIATVDRAINSTRTHLFD--SRPRSP-NDLLALFRYPRDPYT 666

  Fly   698 IGRGEFGDVFVGKLKATLVTSPSDKDADTEKQHSNSENGSGGSGSGSTTLSTLNEKRRSKTSMDD 762
            :|:...|::|                                    ..||..:.|          
  Rat   667 VGQARAGEIF------------------------------------ERTLQLIQE---------- 685

  Fly   763 IEEIKEEEQDQHNQSGL-----------EQLVLVKALNKVKDEQACQEFRRQLDLLRAISHKGVV 816
                       |.|.||           ..||..:.|:.:.:...|...||..:......|:...
  Rat   686 -----------HVQHGLMVDLNGTSYHYNDLVSPQYLSLIANLSGCTAHRRVNNCSDMCFHQKYR 739

  Fly   817 RLFGLCREKDPHYMVLEYTDWGDLKQFLLATAGKVNTATAGSSSPPPLTTSQVLAVAYQIARGMD 881
            ...|.|..       |::..||                       ..||..:         |.:.
  Rat   740 THDGTCNN-------LQHPMWG-----------------------ASLTAFE---------RLLK 765

  Fly   882 AIYRARF-THRDLATRNCVISSEFIVKVSYPALCKDKYSREYHKHRNTLLPIRWLAPECIQEDEY 945
            |:|...| |.|.:.::                       |:|:.|   :||:..|....:...|.
  Rat   766 AVYENGFNTPRGINSQ-----------------------RQYNGH---VLPMPRLVSTTLIGTEV 804

  Fly   946 TTKSDIFAYGVVVWELFNQATKLPHEELTNEQVVQRSQA 984
            .|..:.|.:.::.|..|     |.|:  .:..||..|||
  Rat   805 ITPDEQFTHMLMQWGQF-----LDHD--LDSTVVALSQA 836

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 4/15 (27%)
Ig strand B 133..137 CDD:409353 2/3 (67%)
Ig <135..197 CDD:472250 15/76 (20%)
Ig strand C 150..154 CDD:409353 1/3 (33%)
Ig strand E 171..175 CDD:409353 1/3 (33%)
Ig strand F 185..190 CDD:409353 1/4 (25%)
Ig 265..360 CDD:472250 19/95 (20%)
Ig strand B 272..276 CDD:409571 0/3 (0%)
Ig strand C 290..294 CDD:409571 0/3 (0%)
Ig strand E 337..341 CDD:409571 3/3 (100%)
Ig strand F 351..356 CDD:409571 3/4 (75%)
Ig 395..460 CDD:409353 26/66 (39%)
Ig strand B 395..399 CDD:409353 0/3 (0%)
Ig strand C 408..412 CDD:409353 1/3 (33%)
Ig strand E 430..434 CDD:409353 2/3 (67%)
Ig strand F 444..449 CDD:409353 3/4 (75%)
Ig strand G 457..460 CDD:409353 1/2 (50%)
I-set 468..559 CDD:400151 35/117 (30%)
Ig strand B 486..490 CDD:409570 1/3 (33%)
Ig strand C 499..503 CDD:409570 1/3 (33%)
Ig strand E 525..529 CDD:409570 3/3 (100%)
Ig strand F 539..544 CDD:409570 2/4 (50%)
Ig strand G 552..555 CDD:409570 0/29 (0%)
PTK_CCK4 686..1026 CDD:133178 52/321 (16%)
PxdnNP_001258190.1 leucine-rich repeat 42..60 CDD:275380
leucine-rich repeat 63..84 CDD:275380 3/5 (60%)
LRR <94..>191 CDD:443914 23/107 (21%)
leucine-rich repeat 109..132 CDD:275378 4/22 (18%)
leucine-rich repeat 133..156 CDD:275378 5/28 (18%)
leucine-rich repeat 157..180 CDD:275378 6/25 (24%)
leucine-rich repeat 181..193 CDD:275378 4/11 (36%)
LRRCT 189..240 CDD:214507 8/53 (15%)
I-set 243..330 CDD:400151 23/132 (17%)
Ig strand B 260..264 CDD:409490 0/3 (0%)
Ig strand C 273..277 CDD:409490 0/3 (0%)
Ig strand F 311..316 CDD:409490 3/4 (75%)
Ig strand G 325..328 CDD:409490 0/2 (0%)
I-set 339..426 CDD:400151 33/88 (38%)
Ig strand B 356..360 CDD:409544 1/4 (25%)
Ig strand C 369..373 CDD:409544 1/3 (33%)
Ig strand E 392..396 CDD:409544 2/3 (67%)
Ig strand F 406..411 CDD:409544 3/4 (75%)
Ig strand G 419..422 CDD:409544 1/2 (50%)
Ig3_Peroxidasin 443..516 CDD:143222 28/77 (36%)
Ig strand B 447..451 CDD:143222 1/3 (33%)
Ig strand C 460..464 CDD:143222 1/3 (33%)
Ig strand E 482..486 CDD:143222 3/3 (100%)
Ig strand F 496..501 CDD:143222 2/4 (50%)
Ig strand G 510..513 CDD:143222 0/2 (0%)
Ig4_Peroxidasin 539..607 CDD:143223 20/116 (17%)
Ig strand B 539..543 CDD:143223 3/3 (100%)
Ig strand C 552..556 CDD:143223 0/3 (0%)
Ig strand E 574..578 CDD:143223 3/38 (8%)
Ig strand F 588..593 CDD:143223 1/4 (25%)
Ig strand G 602..605 CDD:143223 1/2 (50%)
peroxidasin_like 861..1300 CDD:188658
VWC 1411..1466 CDD:214564
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.