DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and ptk7a

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001018501.1 Gene:ptk7a / 553690 ZFINID:ZDB-GENE-050522-216 Length:231 Species:Danio rerio


Alignment Length:202 Identity:58/202 - (28%)
Similarity:102/202 - (50%) Gaps:17/202 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVMALMMASVLASSSRFQRVPQSQSVVENESVKFECESTDSYSELHYDWLHNGHRIAYDKRVHQI 75
            |:..::||.  |:|..|.:.|:||..:...|....||..|... :.|.|:.||..:...:|....
Zfish    24 LIGEVIMAQ--AASFYFTKAPKSQDALHGRSAMLRCEVNDPQG-VSYAWIQNGEPVTNSERRFLD 85

  Fly    76 GSNLHIEAVRRTEDVGNYVCIATNLASGAREASPPAKLSVIYLESASVQLLG-------SNRNEL 133
            |.||...|:.||.|.||:.|||:..::|..|.:.....::.:|||.:|.|..       .:.:::
Zfish    86 GGNLKFTAIDRTLDSGNFQCIASKNSTGEEERTAETSFNIKWLESGAVSLKSPESVAEIQSSSQV 150

  Fly   134 LLKCHVEGASGDLEPLEIEWYRNSEKLSTWKNVQLD--QHRLIIRQPGSEDDGLYRCTASNAAGR 196
            :|:|:::|..   .|.. .|:::..:: |.||.:::  :..|.:.....:|:|||.|.|.||||:
Zfish   151 ILRCNIDGHP---RPTN-RWFKDGTQI-TEKNYKINNKERSLTLPNASPDDNGLYFCCAKNAAGQ 210

  Fly   197 VMSKQGY 203
            |.|...:
Zfish   211 VCSSDNF 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 24/67 (36%)
Ig strand B 133..137 CDD:409353 1/3 (33%)
Ig <135..197 CDD:472250 19/63 (30%)
Ig strand C 150..154 CDD:409353 0/3 (0%)
Ig strand E 171..175 CDD:409353 1/3 (33%)
Ig strand F 185..190 CDD:409353 3/4 (75%)
Ig 265..360 CDD:472250
Ig strand B 272..276 CDD:409571
Ig strand C 290..294 CDD:409571
Ig strand E 337..341 CDD:409571
Ig strand F 351..356 CDD:409571
Ig 395..460 CDD:409353
Ig strand B 395..399 CDD:409353
Ig strand C 408..412 CDD:409353
Ig strand E 430..434 CDD:409353
Ig strand F 444..449 CDD:409353
Ig strand G 457..460 CDD:409353
I-set 468..559 CDD:400151
Ig strand B 486..490 CDD:409570
Ig strand C 499..503 CDD:409570
Ig strand E 525..529 CDD:409570
Ig strand F 539..544 CDD:409570
Ig strand G 552..555 CDD:409570
PTK_CCK4 686..1026 CDD:133178
ptk7aNP_001018501.1 Ig 42..122 CDD:472250 26/80 (33%)
Ig strand B 53..57 CDD:409353 0/3 (0%)
Ig strand C 65..70 CDD:409353 1/4 (25%)
Ig strand E 87..91 CDD:409353 2/3 (67%)
Ig strand F 102..107 CDD:409353 2/4 (50%)
Ig 133..222 CDD:472250 23/90 (26%)
Ig strand B 150..154 CDD:409353 1/3 (33%)
Ig strand C 163..167 CDD:409353 0/4 (0%)
Ig strand E 185..189 CDD:409353 1/3 (33%)
Ig strand F 199..204 CDD:409353 3/4 (75%)
Ig strand G 211..214 CDD:409353 1/2 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.