| Sequence 1: | NP_523705.2 | Gene: | otk / 36283 | FlyBaseID: | FBgn0004839 | Length: | 1033 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001018501.1 | Gene: | ptk7a / 553690 | ZFINID: | ZDB-GENE-050522-216 | Length: | 231 | Species: | Danio rerio |
| Alignment Length: | 202 | Identity: | 58/202 - (28%) |
|---|---|---|---|
| Similarity: | 102/202 - (50%) | Gaps: | 17/202 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 11 LVMALMMASVLASSSRFQRVPQSQSVVENESVKFECESTDSYSELHYDWLHNGHRIAYDKRVHQI 75
Fly 76 GSNLHIEAVRRTEDVGNYVCIATNLASGAREASPPAKLSVIYLESASVQLLG-------SNRNEL 133
Fly 134 LLKCHVEGASGDLEPLEIEWYRNSEKLSTWKNVQLD--QHRLIIRQPGSEDDGLYRCTASNAAGR 196
Fly 197 VMSKQGY 203 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| otk | NP_523705.2 | Ig_3 | 31..99 | CDD:464046 | 24/67 (36%) |
| Ig strand B | 133..137 | CDD:409353 | 1/3 (33%) | ||
| Ig | <135..197 | CDD:472250 | 19/63 (30%) | ||
| Ig strand C | 150..154 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 171..175 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 185..190 | CDD:409353 | 3/4 (75%) | ||
| Ig | 265..360 | CDD:472250 | |||
| Ig strand B | 272..276 | CDD:409571 | |||
| Ig strand C | 290..294 | CDD:409571 | |||
| Ig strand E | 337..341 | CDD:409571 | |||
| Ig strand F | 351..356 | CDD:409571 | |||
| Ig | 395..460 | CDD:409353 | |||
| Ig strand B | 395..399 | CDD:409353 | |||
| Ig strand C | 408..412 | CDD:409353 | |||
| Ig strand E | 430..434 | CDD:409353 | |||
| Ig strand F | 444..449 | CDD:409353 | |||
| Ig strand G | 457..460 | CDD:409353 | |||
| I-set | 468..559 | CDD:400151 | |||
| Ig strand B | 486..490 | CDD:409570 | |||
| Ig strand C | 499..503 | CDD:409570 | |||
| Ig strand E | 525..529 | CDD:409570 | |||
| Ig strand F | 539..544 | CDD:409570 | |||
| Ig strand G | 552..555 | CDD:409570 | |||
| PTK_CCK4 | 686..1026 | CDD:133178 | |||
| ptk7a | NP_001018501.1 | Ig | 42..122 | CDD:472250 | 26/80 (33%) |
| Ig strand B | 53..57 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 65..70 | CDD:409353 | 1/4 (25%) | ||
| Ig strand E | 87..91 | CDD:409353 | 2/3 (67%) | ||
| Ig strand F | 102..107 | CDD:409353 | 2/4 (50%) | ||
| Ig | 133..222 | CDD:472250 | 23/90 (26%) | ||
| Ig strand B | 150..154 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 163..167 | CDD:409353 | 0/4 (0%) | ||
| Ig strand E | 185..189 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 199..204 | CDD:409353 | 3/4 (75%) | ||
| Ig strand G | 211..214 | CDD:409353 | 1/2 (50%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||