DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Cntn6

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_059079.2 Gene:Cntn6 / 53870 MGIID:1858223 Length:1028 Species:Mus musculus


Alignment Length:599 Identity:142/599 - (23%)
Similarity:210/599 - (35%) Gaps:157/599 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVMALMMASVLASSSRFQR---VPQSQSVV-----ENESVKFECESTDSYSELHYDWLHNGHRIA 67
            ||:.|.:.:..|...||.|   :.:.|.|:     ....:...| :.:.|...||.|..||..|.
Mouse     7 LVILLPLINSCAGEGRFSRPIFIQEPQDVIFPLDLSRSEIILTC-TANGYPSPHYRWKQNGTDID 70

  Fly    68 YDKRVHQ--IGSNLHIEAVRRTEDVGNYVCIATNLASGAREASPPAKLSVIYLESASVQLLGS-- 128
            :....|.  .|.:|.|.:.|..:|:|.|.|:|||.....  .|..|||...|:|....:...:  
Mouse    71 FGMTYHYRLDGGSLAISSPRTDQDIGIYQCLATNPVGTI--LSRKAKLQFAYIEDFETKTRSTVS 133

  Fly   129 --NRNELLLKCHVEGASGDLEPLEIEWYRNSEKLSTWKNVQLDQHRLIIRQPGS--------EDD 183
              ....::|.|   |.......|...|..|...|    .||.|:.|.:.:..|:        .|.
Mouse   134 VREGQGVVLLC---GPPPHFGELSYAWTFNDSPL----YVQEDKRRFVSQDTGNLYFAKVEPSDV 191

  Fly   184 GLYRCTASNAAGR----------VMSKQGYVYQSSVKCLPRLPRRKNEKMMESWDKQTFLCRGKR 238
            |.|.|..:|....          |:...|.:.:...|...|.|                      
Mouse   192 GNYTCFVTNKEAHRSVQGPPTPLVLRTDGVMGEYEPKIEVRFP---------------------- 234

  Fly   239 GGAAGLEALPAAPEDLRIVQGPIGQSIIKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQV 303
                  |.:.||.:           |.||      |.|.     .|.|....:.|::        
Mouse   235 ------ETIQAAKD-----------SSIK------LECF-----ALGNPVPDISWKR-------- 263

  Fly   304 ELGGSAPIPGHSFDSGKDALLREDARLVLHKQNGTLSFASIIASDAGQYQC-----------QLQ 357
             |.|| |:||               ::...|....|........|.|.|:|           :.|
Mouse   264 -LDGS-PMPG---------------KIKYSKSQAILEIPKFQQEDEGFYECIAGNLRGRNLAKGQ 311

  Fly   358 LEAHAPINSSPGI----LEVIEQLKFVPQPTSKNLELDAVVAKVHCKAQGTPTPQVQWVRDGENT 418
            |..:||......|    |.:.:.|.:                  .|||.|.|.|...|:::|:..
Mouse   312 LIFYAPPEWEQKIQNTYLSIYDSLFW------------------ECKASGNPNPSYTWLKNGQRL 358

  Fly   419 TLPDHVEVDANGTLIFRNVNSEHRGNYTCLATNSQGQINATVAINVVVT-PKFSVPPVGPIETSE 482
            ...:.:::: |||||...:|....|.|.|.|.|....|.|...:.|:.: |.||..|:..|...:
Mouse   359 NTEERIQIE-NGTLIITMLNISDSGIYQCAAENKYQTIYANAELRVLASAPDFSKNPIKKISVVQ 422

  Fly   483 -QGTVVMHCQAIGDPKPTIQWDKDLKYLSENNTDRERFRFLENGTLEIRNVQVEDEGSYGCTIGN 546
             .|.:.:.|:....||.:|.|.:.    :||....:|..|||:|:|:|.||...|.|||.|...|
Mouse   423 VGGDISIECKPNAFPKASISWKRG----TENLKQSKRVLFLEDGSLKICNVTRADAGSYTCVATN 483

  Fly   547 SAGLKREDVQLVVK 560
            ..|..:....||||
Mouse   484 QFGNGKSSGGLVVK 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 20/74 (27%)
Ig strand B 133..137 CDD:409353 1/3 (33%)
Ig <135..197 CDD:472250 17/79 (22%)
Ig strand C 150..154 CDD:409353 0/3 (0%)
Ig strand E 171..175 CDD:409353 1/3 (33%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 21/105 (20%)
Ig strand B 272..276 CDD:409571 1/3 (33%)
Ig strand C 290..294 CDD:409571 0/3 (0%)
Ig strand E 337..341 CDD:409571 1/3 (33%)
Ig strand F 351..356 CDD:409571 2/15 (13%)
Ig 395..460 CDD:409353 21/64 (33%)
Ig strand B 395..399 CDD:409353 0/3 (0%)
Ig strand C 408..412 CDD:409353 0/3 (0%)
Ig strand E 430..434 CDD:409353 3/3 (100%)
Ig strand F 444..449 CDD:409353 2/4 (50%)
Ig strand G 457..460 CDD:409353 1/2 (50%)
I-set 468..559 CDD:400151 30/91 (33%)
Ig strand B 486..490 CDD:409570 0/3 (0%)
Ig strand C 499..503 CDD:409570 1/3 (33%)
Ig strand E 525..529 CDD:409570 2/3 (67%)
Ig strand F 539..544 CDD:409570 3/4 (75%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178
Cntn6NP_059079.2 Ig 26..120 CDD:472250 26/96 (27%)
Ig strand B 46..50 CDD:409353 0/3 (0%)
Ig strand C 59..63 CDD:409353 2/3 (67%)
Ig strand E 82..86 CDD:409353 1/3 (33%)
Ig strand F 97..102 CDD:409353 2/4 (50%)
Ig strand G 111..114 CDD:409353 1/2 (50%)
Ig 129..214 CDD:472250 17/91 (19%)
Ig strand B 140..144 CDD:409353 1/3 (33%)
Ig strand C 154..158 CDD:409353 0/3 (0%)
Ig strand E 179..183 CDD:409353 1/3 (33%)
Ig strand F 193..198 CDD:409353 2/4 (50%)
Ig strand G 209..212 CDD:409353 0/2 (0%)
Ig 227..315 CDD:472250 28/162 (17%)
Ig strand B 245..249 CDD:409353 3/9 (33%)
Ig strand C 258..262 CDD:409353 0/3 (0%)
Ig strand E 280..284 CDD:409353 1/3 (33%)
Ig strand F 294..299 CDD:409353 2/4 (50%)
Ig strand G 307..310 CDD:409353 0/2 (0%)
Ig 319..403 CDD:472250 24/102 (24%)
Ig strand B 335..339 CDD:143205 1/21 (5%)
Ig strand C 348..352 CDD:143205 0/3 (0%)
Ig strand E 369..373 CDD:143205 3/3 (100%)
Ig strand F 383..388 CDD:143205 2/4 (50%)
Ig strand G 396..399 CDD:143205 1/2 (50%)
Ig5_Contactin 408..496 CDD:409358 30/91 (33%)
Ig strand A 408..413 CDD:409358 3/4 (75%)
Ig strand A' 416..421 CDD:409358 1/4 (25%)
Ig strand B 425..432 CDD:409358 1/6 (17%)
Ig strand C 440..444 CDD:409358 1/3 (33%)
Ig strand D 458..461 CDD:409358 2/2 (100%)
Ig strand E 462..467 CDD:409358 2/4 (50%)
Ig strand F 475..483 CDD:409358 4/7 (57%)
Ig strand G 489..496 CDD:409358 1/6 (17%)
Ig 500..598 CDD:472250
Ig strand B 517..521 CDD:409353
Ig strand C 532..536 CDD:409353
Ig strand E 560..564 CDD:409353
Ig strand F 574..579 CDD:409353
Ig strand G 587..590 CDD:409353
FN3 598..691 CDD:238020
FN3 <620..>912 CDD:442628
FN3 903..983 CDD:214495
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.