DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment otk and CFP

DIOPT Version :9

Sequence 1:	NP_523705.2	Gene:	otk / 36283	FlyBaseID:	FBgn0004839	Length:	1033	Species:	Drosophila melanogaster
Sequence 2:	NP_001138724.1	Gene:	CFP / 5199	HGNCID:	8864	Length:	469	Species:	Homo sapiens

Alignment Length:	174	Identity:	33/174 - (18%)
Similarity:	55/174 - (31%)	Gaps:	71/174 - (40%)

- Green bases have known domain annotations that are detailed below.

  Fly   148 PLEIEW----------YRNSEKLS------------TWKNVQLDQHRLIIRQPGSEDD-----GL 185
            |::.||          .||.:.:|            |.:..:.|.||.    .|.:.|     .:
Human   313 PVDGEWDSWGEWSPCIRRNMKSISCQEIPGQQSRGRTCRGRKFDGHRC----AGQQQDIRHCYSI 373

  Fly   186 YRCTASNAAGRVMSKQGYVYQSSVKCLPRL---PRRKNEKMMESWDKQTFLCRGKRGGAAGLEAL 247
            ..|....:... .|..|.       |:|..   |.|..::          ||         ...|
Human   374 QHCPLKGSWSE-WSTWGL-------CMPPCGPNPTRARQR----------LC---------TPLL 411

  Fly   248 PAAPEDLRIVQGPIGQSIIKEGEPTALTCLYELP--DELKNQRI 289
            |..|..:.:|:|...:::...|.|        ||  :||:.|::
Human   412 PKYPPTVSMVEGQGEKNVTFWGRP--------LPRCEELQGQKL 447

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
otk	NP_523705.2	I-set	26..115	CDD:254352
		Ig	31..115	CDD:299845
		IGc2	133..195	CDD:197706	13/73 (18%)
		Ig	268..373	CDD:299845	7/24 (29%)
		Ig	395..460	CDD:143165
		I-set	468..559	CDD:254352
		IGc2	484..549	CDD:197706
		PTK_CCK4	686..1026	CDD:133178
		STYKc	692..1020	CDD:214568
CFP	NP_001138724.1	TSP_1	81..132	CDD:306574
		TSP_1	140..184	CDD:306574
		TSP1	196..255	CDD:214559
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	219..238
		TSP_1	261..312	CDD:306574
		Interaction with Compliment C3 beta chain. /evidence=ECO:0000269\|PubMed:28264884, ECO:0000269\|PubMed:31507604	351..359		1/7 (14%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4475
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900