DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Dscam1

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:1112 Identity:223/1112 - (20%)
Similarity:361/1112 - (32%) Gaps:385/1112 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 PQSQSVVENESVKFECESTDSYSELHYDWLHNGHRIAYDKRVHQIGSNLHIEAVRRTEDVGNYVC 95
            |.:|:|.......|.|:.|.:..:. ..|:.:|..|.:.:.|      |.||:|:: ||.|.|.|
  Fly   353 PPTQTVDFGRPAVFTCQYTGNPIKT-VSWMKDGKAIGHSEPV------LRIESVKK-EDKGMYQC 409

  Fly    96 IATNLASGAREASPPAKLSVIYLESASVQLLGSNRNE----LLLKCHVEGASGDLEPLEIEWYRN 156
            ...|....| |||...||...:......|.......|    :.|||   .|.|:..| ||.|..:
  Fly   410 FVRNDQESA-EASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKC---VAGGNPTP-EISWELD 469

  Fly   157 SEKLSTWKNVQLDQH---------RLIIRQPGSEDDGLYRCTASNAAG----------------R 196
            .:|::.....|:.|:         .|.|....:.|.|||:|.|.:..|                |
  Fly   470 GKKIANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIR 534

  Fly   197 VMSKQ---------------GY-----VYQSSVKCLPRLPRRKN---------EKMMESWDKQTF 232
            .|.|:               ||     |::...:.|| :.|::.         |.:..:.|:.|:
  Fly   535 QMEKKAIVAGETLIVTCPVAGYPIDSIVWERDNRALP-INRKQKVFPNGTLIIENVERNSDQATY 598

  Fly   233 LC--RGKRGGAA--GLEA--------LPAAPEDLRIVQGPIGQSIIKEGEPTALTCLYELPDELK 285
            .|  :.:.|.:|  .||.        :|.|.|||           |..|:...|.|..:..|   
  Fly   599 TCVAKNQEGYSARGSLEVQVMVLPQIVPFAYEDL-----------INMGDSIDLFCQIQKGD--- 649

  Fly   286 NQRIQLRW---RKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDARLVLHKQNGTLSFASIIAS 347
             :.|::.|   |..|                   |.|.|.:..:.....:.::...:|..|...:
  Fly   650 -RPIKVHWSFERSAG-------------------DYGFDQVQPQMRTNRISEKTSMISIPSASPA 694

  Fly   348 DAGQYQCQLQLEA-------HAPINSSPGILEVIEQLKFVPQPTSKNLELDAVVAKVHCKAQGTP 405
            ..|:..|....:|       ...:|..|         :::.:||.|.. .....|||.|||.|.|
  Fly   695 HTGRDTCIASNKAGTTTYSVDLTVNVPP---------RWILEPTDKAF-AQGSDAKVECKADGFP 749

  Fly   406 TPQVQWVR-----DGENTTL--PDHVEVDANGTLIFRNVNSEHRGNYTCLATNSQGQ-INATVAI 462
            .|||.|.:     .||...|  .|::.|: .|||...|:...:.|.|.|.|.|..|. ::|.:.|
  Fly   750 KPQVTWKKAVGDTPGEYKDLKKSDNIRVE-EGTLHVDNIQKTNEGYYLCEAINGIGSGLSAVIMI 813

  Fly   463 NVVVTPKFSVPPVGPIETSEQG-TVVMHCQAIGDPKPTIQWDKDLKYLSENNTDRERFR--FLEN 524
            :|...|:|:.....  :|:.:| ..|:.|:|.|:....|.|:.:...|...|.:|...|  .|..
  Fly   814 SVQAPPEFTEKLRN--QTARRGEPAVLQCEAKGEKPIGILWNMNNMRLDPKNDNRYTIREEILST 876

  Fly   525 G---TLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEESGGDGFLVTRAVLITM 586
            |   :|.|:..:..|...:.|...|:.|.....:.::|:.     .||                 
  Fly   877 GVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQE-----VPE----------------- 919

  Fly   587 TVALAYIVLVVGLMLWCRYRRQARKARLNDLSTKEAGGDQPDVAGNGKGSEQEPCLSKQHNGHSK 651
               :.|.:.|:.        :..|..:|:                          .::.::|:|.
  Fly   920 ---MPYALKVLD--------KSGRSVQLS--------------------------WAQPYDGNSP 947

  Fly   652 --------SRSKSSGD-------AQKSDDTACSQQSRASKKSAHIYEQLALPRSGLSELIQIGRG 701
                    .||::|..       ...:.:....:.|.|:..:..|..:.|:..|..||.:.|   
  Fly   948 LDRYIIEFKRSRASWSEIDRVIVPGHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTI--- 1009

  Fly   702 EFGDVFVGKLKATLVTSPSDKDADTEKQHSNSE--------------NGSGGSGSGSTTLSTLNE 752
                       .|...:||.|..:.:.:..|..              ||..........||..|.
  Fly  1010 -----------ITAEEAPSGKPQNIKVEPVNQTTMRVTWKPPPRTEWNGEILGYYVGYKLSNTNS 1063

  Fly   753 KRRSKTSMDDIEEIKEEEQDQHNQSGLEQL-VLVKALNKVKDEQACQEFRRQLDLLRAISHKGVV 816
            ....:|.....||.||...:..|.....|. |:::|.||:                      |. 
  Fly  1064 SYVFETINFITEEGKEHNLELQNLRVYTQYSVVIQAFNKI----------------------GA- 1105

  Fly   817 RLFGLCREKDPHYMVLEYTDWGDLKQFLLATAGKVNTATAGSSSPPPLT-----TSQVLAVAY-- 874
               |...|::              |||         ||....|.||..|     |||.:.|.:  
  Fly  1106 ---GPLSEEE--------------KQF---------TAEGTPSQPPSDTACTTLTSQTIRVGWVS 1144

  Fly   875 ---QIARGMDAIYRARFTHRDLATRNCVISSEFIVKVSYPALCKDKYSREYHKHRNTLLPIRWLA 936
               :.|.|:...|:..:...|          |:.          |:..|.|.|            
  Fly  1145 PPLESANGVIKTYKVVYAPSD----------EWY----------DETKRHYKK------------ 1177

  Fly   937 PECIQEDEYTTKSDIFAYGVVVWELFNQATKLPHEELTN--EQVVQRSQAGSLEWSVAEATPDSL 999
                     |..||...:|:              ::.||  .||:..:..|           |.:
  Fly  1178 ---------TASSDTVLHGL--------------KKYTNYTMQVLATTAGG-----------DGV 1208

  Fly  1000 REILLSC 1006
            |.:.:.|
  Fly  1209 RSVPIHC 1215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 19/67 (28%)
Ig strand B 133..137 CDD:409353 1/3 (33%)
Ig <135..197 CDD:472250 21/86 (24%)
Ig strand C 150..154 CDD:409353 2/3 (67%)
Ig strand E 171..175 CDD:409353 1/12 (8%)
Ig strand F 185..190 CDD:409353 3/4 (75%)
Ig 265..360 CDD:472250 16/97 (16%)
Ig strand B 272..276 CDD:409571 1/3 (33%)
Ig strand C 290..294 CDD:409571 1/6 (17%)
Ig strand E 337..341 CDD:409571 0/3 (0%)
Ig strand F 351..356 CDD:409571 1/4 (25%)
Ig 395..460 CDD:409353 28/72 (39%)
Ig strand B 395..399 CDD:409353 3/3 (100%)
Ig strand C 408..412 CDD:409353 2/3 (67%)
Ig strand E 430..434 CDD:409353 3/3 (100%)
Ig strand F 444..449 CDD:409353 2/4 (50%)
Ig strand G 457..460 CDD:409353 1/2 (50%)
I-set 468..559 CDD:400151 22/96 (23%)
Ig strand B 486..490 CDD:409570 1/3 (33%)
Ig strand C 499..503 CDD:409570 1/3 (33%)
Ig strand E 525..529 CDD:409570 2/6 (33%)
Ig strand F 539..544 CDD:409570 1/4 (25%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178 63/348 (18%)
Dscam1NP_001246162.1 IgI_1_Dscam 38..136 CDD:409547
Ig strand A 39..42 CDD:409547
Ig strand A' 48..52 CDD:409547
Ig strand B 55..64 CDD:409547
Ig strand C 70..76 CDD:409547
Ig strand C' 78..81 CDD:409547
Ig strand D 87..90 CDD:409547
Ig strand E 95..100 CDD:409547
Ig strand F 113..121 CDD:409547
Ig strand G 124..136 CDD:409547
IgI_2_Dscam 246..343 CDD:409545
Ig strand A 247..250 CDD:409545
Ig strand A' 260..264 CDD:409545
Ig strand B 267..274 CDD:409545
Ig strand C 282..288 CDD:409545
Ig strand C' 294..297 CDD:409545
Ig strand D 303..307 CDD:409545
Ig strand E 309..315 CDD:409545
Ig strand F 322..330 CDD:409545
Ig strand G 333..343 CDD:409545
IgC2_3_Dscam 346..426 CDD:409549 24/81 (30%)
Ig strand A 347..352 CDD:409549
Ig strand A' 355..359 CDD:409549 1/3 (33%)
Ig strand B 362..372 CDD:409549 2/9 (22%)
Ig strand C 377..383 CDD:409549 1/6 (17%)
Ig strand C' 384..387 CDD:409549 1/2 (50%)
Ig strand E 392..398 CDD:409549 3/11 (27%)
Ig strand F 405..413 CDD:409549 3/7 (43%)
Ig strand G 416..426 CDD:409549 4/10 (40%)
IgI_4_Dscam 432..527 CDD:409548 23/98 (23%)
Ig strand A 432..435 CDD:409548 0/2 (0%)
Ig strand A' 441..445 CDD:409548 0/3 (0%)
Ig strand B 448..457 CDD:409548 3/11 (27%)
Ig strand C 462..468 CDD:409548 4/6 (67%)
Ig strand C' 470..473 CDD:409548 0/2 (0%)
Ig strand D 478..486 CDD:409548 2/7 (29%)
Ig strand E 490..499 CDD:409548 2/8 (25%)
Ig strand F 506..514 CDD:409548 5/7 (71%)
Ig strand G 517..527 CDD:409548 1/9 (11%)
IgI_5_Dscam 531..618 CDD:409550 17/87 (20%)
Ig strand A 531..533 CDD:409550 0/1 (0%)
Ig strand A' 538..542 CDD:409550 1/3 (33%)
Ig strand B 545..552 CDD:409550 0/6 (0%)
Ig strand C 559..565 CDD:409550 1/5 (20%)
Ig strand C' 566..568 CDD:409550 0/1 (0%)
Ig strand D 575..579 CDD:409550 0/3 (0%)
Ig strand E 582..588 CDD:409550 0/5 (0%)
Ig strand F 596..604 CDD:409550 2/7 (29%)
Ig strand G 608..618 CDD:409550 3/9 (33%)
Ig 621..718 CDD:472250 22/130 (17%)
Ig strand B 639..643 CDD:409353 1/3 (33%)
Ig strand C 653..657 CDD:409353 0/3 (0%)
Ig strand E 684..688 CDD:409353 0/3 (0%)
Ig strand F 698..703 CDD:409353 1/4 (25%)
Ig strand G 711..714 CDD:409353 0/2 (0%)
IgI_7_Dscam 721..815 CDD:409546 33/104 (32%)
Ig strand A 721..725 CDD:409546 1/12 (8%)
Ig strand A' 730..734 CDD:409546 1/4 (25%)
Ig strand B 737..746 CDD:409546 5/8 (63%)
Ig strand C 752..758 CDD:409546 3/5 (60%)
Ig strand C' 764..767 CDD:409546 2/2 (100%)
Ig strand D 775..778 CDD:409546 0/2 (0%)
Ig strand E 780..786 CDD:409546 3/5 (60%)
Ig strand F 793..801 CDD:409546 4/7 (57%)
Ig strand G 806..815 CDD:409546 2/8 (25%)
Ig 818..916 CDD:472250 23/99 (23%)
Ig strand B 836..840 CDD:409353 1/3 (33%)
Ig strand C 849..853 CDD:409353 1/3 (33%)
Ig strand E 880..884 CDD:409353 1/3 (33%)
Ig strand F 894..899 CDD:409353 1/4 (25%)
FN3 <899..1212 CDD:442628 79/500 (16%)
Ig strand G 907..910 CDD:409353 0/2 (0%)
FN3 1222..1312 CDD:238020
Ig <1339..1406 CDD:472250
Ig strand C 1350..1354 CDD:409358
Ig strand E 1372..1376 CDD:409358
Ig strand F 1386..1391 CDD:409358
Ig strand G 1399..1402 CDD:409358
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1893..2008 CDD:463546
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.