DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and IL1RAP

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001161403.1 Gene:IL1RAP / 3556 HGNCID:5995 Length:687 Species:Homo sapiens


Alignment Length:388 Identity:85/388 - (21%)
Similarity:142/388 - (36%) Gaps:97/388 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 EGEPTALTC-LYELPDELK-------NQRIQLRW---RKDGKLLRQVELGGSAPIPGHSFDSGKD 321
            |.||..:.| |:|  ..||       :..:.|.|   |:|    |.:|...:..:|.:.....||
Human    39 EDEPARIKCPLFE--HFLKFNYSTAHSAGLTLIWYWTRQD----RDLEEPINFRLPENRISKEKD 97

  Fly   322 ALLREDARLVLHKQNGTLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPTS- 385
            .|.                |...:.:|.|.|.|.|:...:....:.|  |||:::......|.. 
Human    98 VLW----------------FRPTLLNDTGNYTCMLRNTTYCSKVAFP--LEVVQKDSCFNSPMKL 144

  Fly   386 --KNLELDAVVAKVHC-KAQG----TPTPQVQWVR-----DGENTTLPDHVEVDANGTLIFRNVN 438
              ..|.::..:.::.| ...|    :..|.:.|..     ...|..:|:.:.:.....||..|  
Human   145 PVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNN-- 207

  Fly   439 SEHRGNYTCLATNSQG----QINATVAINVVVTPKFSVPPV--GP----IETSEQG-TVVMHCQA 492
                |||||:.|..:.    .:..|:.:.||.:||.:||||  .|    :...|.| .:::.|..
Human   208 ----GNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVPPVIHSPNDHVVYEKEPGEELLIPCTV 268

  Fly   493 ----IGDPKPTIQWDKDLK-------------YLSENNTDRERFRFLENGTLEIRNVQVED-EGS 539
                :.|.:..:.|..|.|             .:|.:.|:.|    .....|.|:.|..|| :.|
Human   269 YFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDE----TRTQILSIKKVTSEDLKRS 329

  Fly   540 YGCTIGNSAGLKREDVQLVVKTTGDGFAPEESGGDGFLVTRAVLITMTVALAYIVLVVGLMLW 602
            |.|...::.|...:..::..|.....:..|.:.|.|          .||.|..|::||..:.|
Human   330 YVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFG----------ATVLLVVILIVVYHVYW 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845 26/115 (23%)
Ig 395..460 CDD:143165 15/78 (19%)
I-set 468..559 CDD:254352 26/115 (23%)
IGc2 484..549 CDD:197706 17/83 (20%)
PTK_CCK4 686..1026 CDD:133178
STYKc 692..1020 CDD:214568
IL1RAPNP_001161403.1 Ig1_IL1R_like 25..132 CDD:409584 27/116 (23%)
Ig strand B 43..47 CDD:409584 0/3 (0%)
Ig strand C 67..71 CDD:409584 1/3 (33%)
Ig strand E 97..101 CDD:409584 2/19 (11%)
Ig strand F 111..116 CDD:409584 2/4 (50%)
Ig strand G 124..127 CDD:409584 0/2 (0%)
Ig2_IL-1RAP_like 143..235 CDD:409585 18/97 (19%)
Ig strand B 156..160 CDD:409585 0/3 (0%)
Ig strand C 174..178 CDD:409585 0/3 (0%)
Ig strand E 195..199 CDD:409585 0/3 (0%)
Ig strand F 209..214 CDD:409585 4/4 (100%)
Ig strand G 226..229 CDD:409585 0/2 (0%)
Ig3_IL1RAP 243..349 CDD:409525 22/109 (20%)
Ig strand B 262..266 CDD:409525 0/3 (0%)
Ig strand C 279..283 CDD:409525 0/3 (0%)
Ig strand E 314..318 CDD:409525 1/3 (33%)
Ig strand F 329..334 CDD:409525 3/4 (75%)
Ig strand G 341..344 CDD:409525 0/2 (0%)
TIR 404..547 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.