DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Ror

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:329 Identity:96/329 - (29%)
Similarity:181/329 - (55%) Gaps:32/329 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   716 VTSPS-DKDADTEKQHSNSEN-GSGGSGSGSTTLSTLNEK--------RRSKTSMDDIEEIKEEE 770
            :.:|| ||:.....|.:|::: |.|..|:.|..:: ||.|        |.:..::.|:|.::|..
  Fly   354 INTPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVA-LNSKLIERNTLLRINHFTLQDVEFLEELG 417

  Fly   771 QDQHNQSGLEQL---------VLVKALNKVKDEQACQEFRRQLDLLRAISHKGVVRLFGLCREKD 826
            :....:....||         |.:|||.:....:..|:|:|:::|:..:.|:.:|.:.|:...|:
  Fly   418 EGAFGKVYKGQLLQPNKTTITVAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLNKE 482

  Fly   827 PHYMVLEYTDWGDLKQFLLATAGKVNTATAGSSSPPPLTTSQVLAVAYQIARGMDAIYRARFTHR 891
            |:.|:.||...|||.:||::     |:.|.|.|    |:..:.|.:|.||:.||..:....:.||
  Fly   483 PYCMLFEYMANGDLHEFLIS-----NSPTEGKS----LSQLEFLQIALQISEGMQYLSAHHYVHR 538

  Fly   892 DLATRNCVISSEFIVKVSYPALCKDKYSREYHK-HRNTLLPIRWLAPECIQEDEYTTKSDIFAYG 955
            |||.|||:::...:||:|...|.:|.||.:|:: ...:|||:||:..|.|...::||:||::::|
  Fly   539 DLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGKFTTESDVWSFG 603

  Fly   956 VVVWELFNQATKLPHEELTNEQVVQRSQAGSLEWSVAEATPDSLREILLSCWVSNPKERPSFSQL 1020
            ||:||:::...: |:...:|::|:...::..| .|..|..|.::..:::.||.....:||:|:.:
  Fly   604 VVLWEIYSYGMQ-PYYGFSNQEVINLIRSRQL-LSAPENCPTAVYSLMIECWHEQSVKRPTFTDI 666

  Fly  1021 GAAL 1024
            ...|
  Fly   667 SNRL 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845
Ig 395..460 CDD:143165
I-set 468..559 CDD:254352
IGc2 484..549 CDD:197706
PTK_CCK4 686..1026 CDD:133178 96/329 (29%)
STYKc 692..1020 CDD:214568 95/323 (29%)
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 82/278 (29%)
Pkinase_Tyr 410..670 CDD:285015 80/270 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1026
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.