DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Ror

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_476962.1 Gene:Ror / 34367 FlyBaseID:FBgn0010407 Length:685 Species:Drosophila melanogaster


Alignment Length:329 Identity:96/329 - (29%)
Similarity:181/329 - (55%) Gaps:32/329 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   716 VTSPS-DKDADTEKQHSNSEN-GSGGSGSGSTTLSTLNEK--------RRSKTSMDDIEEIKEEE 770
            :.:|| ||:.....|.:|::: |.|..|:.|..:: ||.|        |.:..::.|:|.::|..
  Fly   354 INTPSADKNIYGNSQLNNAQDAGRGNLGNLSDHVA-LNSKLIERNTLLRINHFTLQDVEFLEELG 417

  Fly   771 QDQHNQSGLEQL---------VLVKALNKVKDEQACQEFRRQLDLLRAISHKGVVRLFGLCREKD 826
            :....:....||         |.:|||.:....:..|:|:|:::|:..:.|:.:|.:.|:...|:
  Fly   418 EGAFGKVYKGQLLQPNKTTITVAIKALKENASVKTQQDFKREIELISDLKHQNIVCILGVVLNKE 482

  Fly   827 PHYMVLEYTDWGDLKQFLLATAGKVNTATAGSSSPPPLTTSQVLAVAYQIARGMDAIYRARFTHR 891
            |:.|:.||...|||.:||::     |:.|.|.|    |:..:.|.:|.||:.||..:....:.||
  Fly   483 PYCMLFEYMANGDLHEFLIS-----NSPTEGKS----LSQLEFLQIALQISEGMQYLSAHHYVHR 538

  Fly   892 DLATRNCVISSEFIVKVSYPALCKDKYSREYHK-HRNTLLPIRWLAPECIQEDEYTTKSDIFAYG 955
            |||.|||:::...:||:|...|.:|.||.:|:: ...:|||:||:..|.|...::||:||::::|
  Fly   539 DLAARNCLVNEGLVVKISDFGLSRDIYSSDYYRVQSKSLLPVRWMPSESILYGKFTTESDVWSFG 603

  Fly   956 VVVWELFNQATKLPHEELTNEQVVQRSQAGSLEWSVAEATPDSLREILLSCWVSNPKERPSFSQL 1020
            ||:||:::...: |:...:|::|:...::..| .|..|..|.::..:::.||.....:||:|:.:
  Fly   604 VVLWEIYSYGMQ-PYYGFSNQEVINLIRSRQL-LSAPENCPTAVYSLMIECWHEQSVKRPTFTDI 666

  Fly  1021 GAAL 1024
            ...|
  Fly   667 SNRL 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046
Ig strand B 133..137 CDD:409353
Ig <135..197 CDD:472250
Ig strand C 150..154 CDD:409353
Ig strand E 171..175 CDD:409353
Ig strand F 185..190 CDD:409353
Ig 265..360 CDD:472250
Ig strand B 272..276 CDD:409571
Ig strand C 290..294 CDD:409571
Ig strand E 337..341 CDD:409571
Ig strand F 351..356 CDD:409571
Ig 395..460 CDD:409353
Ig strand B 395..399 CDD:409353
Ig strand C 408..412 CDD:409353
Ig strand E 430..434 CDD:409353
Ig strand F 444..449 CDD:409353
Ig strand G 457..460 CDD:409353
I-set 468..559 CDD:400151
Ig strand B 486..490 CDD:409570
Ig strand C 499..503 CDD:409570
Ig strand E 525..529 CDD:409570
Ig strand F 539..544 CDD:409570
Ig strand G 552..555 CDD:409570
PTK_CCK4 686..1026 CDD:133178 96/329 (29%)
RorNP_476962.1 CRD_TK_ROR_like 39..228 CDD:143568
KR 235..312 CDD:214527
PTKc_Ror 404..673 CDD:270642 82/278 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.