DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and bsg

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_937785.2 Gene:bsg / 337692 ZFINID:ZDB-GENE-030131-9638 Length:392 Species:Danio rerio


Alignment Length:386 Identity:77/386 - (19%)
Similarity:147/386 - (38%) Gaps:90/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 EALPAAPEDLRIVQGPIGQSIIKEGEPTALTCLYELPDELKNQRIQLRW-----RKDGKLLRQVE 304
            ||:.|.     .::.|:.|..:.| :...|.|     :.:.|...:::|     .:..:::.|: 
Zfish    20 EAMTAG-----FIKSPLSQMKLIE-DNAELDC-----EVIGNPIPEVQWWFIEGEEPDEIITQL- 72

  Fly   305 LGGSAPIPGHSFDSGKDALLREDARLVLHKQNGTLSFASIIASDAGQYQCQL-----QLEAHAP- 363
                       ||..::..:..:|..:.| ...:|...::..:|.|.|:|:.     :.:...| 
Zfish    73 -----------FDGAREDRVHINATYIDH-ATSSLILTNLTFNDTGVYECRASNDPDRNDLRTPP 125

  Fly   364 ----INSSPGILEVIEQLKFVPQPTSKNLELDAVVAKVHCKA--QGTPTPQVQWVRDGENTTLPD 422
                |.|...:: |.|:...:..|...|    |..|.:.|..  ..:|.....||::|:......
Zfish   126 KVKWIRSQANVI-VFERATIMTSPEVNN----ATSATLSCNLTNPSSPIKGHYWVKNGKKIEESY 185

  Fly   423 HVEVDANGTLIFRNVNSEHRGNYTCLATNSQGQINATVAINVVVTPKFSVPPVGPIETSEQGT-- 485
            ....|:.........:..|.|.|||:.. ::.|.|||:.:.       ::|.:...::||...  
Zfish   186 STNTDSYAEHFIEKADYHHSGIYTCVFL-TEPQANATIEVK-------ALPHIKASKSSENANEK 242

  Fly   486 --VVMHCQAIGDPKPT-IQWDK--------------DLKYLSENNTDRERFRFLENGTLEIRNVQ 533
              .|:.|.:.|.|.|| ..|.|              |.||..::..::.        ||.::::.
Zfish   243 DKAVLSCGSQGYPSPTDWSWFKLPDAGERTPIFNGTDDKYEIKSTPNKT--------TLYVKDLD 299

  Fly   534 V-EDEGSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEESGGDGFL-VTRAVLITMTVALAY 592
            : ||.|.|.|...:..|...:|:||.|::......|       || :...|:|.:|:...|
Zfish   300 INEDMGFYQCQGTSEVGTGTDDIQLRVRSQLAALWP-------FLGIVAEVIILITIIFVY 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046
Ig strand B 133..137 CDD:409353
Ig <135..197 CDD:472250
Ig strand C 150..154 CDD:409353
Ig strand E 171..175 CDD:409353
Ig strand F 185..190 CDD:409353
Ig 265..360 CDD:472250 15/104 (14%)
Ig strand B 272..276 CDD:409571 1/3 (33%)
Ig strand C 290..294 CDD:409571 1/8 (13%)
Ig strand E 337..341 CDD:409571 1/3 (33%)
Ig strand F 351..356 CDD:409571 2/4 (50%)
Ig 395..460 CDD:409353 15/66 (23%)
Ig strand B 395..399 CDD:409353 1/3 (33%)
Ig strand C 408..412 CDD:409353 0/3 (0%)
Ig strand E 430..434 CDD:409353 0/3 (0%)
Ig strand F 444..449 CDD:409353 3/4 (75%)
Ig strand G 457..460 CDD:409353 2/2 (100%)
I-set 468..559 CDD:400151 25/110 (23%)
Ig strand B 486..490 CDD:409570 1/3 (33%)
Ig strand C 499..503 CDD:409570 1/4 (25%)
Ig strand E 525..529 CDD:409570 2/3 (67%)
Ig strand F 539..544 CDD:409570 2/4 (50%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178
bsgNP_937785.2 Ig 24..140 CDD:472250 22/140 (16%)
Ig strand B 41..45 CDD:409534 1/3 (33%)
Ig strand C 54..58 CDD:409534 0/3 (0%)
Ig strand E 93..97 CDD:409534 1/3 (33%)
Ig strand F 107..112 CDD:409534 2/4 (50%)
Ig strand G 131..134 CDD:409534 1/2 (50%)
Ig 156..211 CDD:409353 11/54 (20%)
Ig strand B 156..160 CDD:409353 1/3 (33%)
Ig strand C 169..175 CDD:409353 0/5 (0%)
Ig strand F 207..211 CDD:409353 2/3 (67%)
IG_like 235..326 CDD:214653 24/98 (24%)
Ig strand B 245..249 CDD:409353 1/3 (33%)
Ig strand C 259..263 CDD:409353 0/3 (0%)
Ig strand E 291..295 CDD:409353 2/11 (18%)
Ig strand F 306..311 CDD:409353 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.