DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and bdl

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:665 Identity:143/665 - (21%)
Similarity:235/665 - (35%) Gaps:195/665 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 PAKLSVIYLESASVQL-----------------------------LGSNRNELLLKCHVEGASGD 145
            |||.|..:.:|.|..|                             :||:   ::..|:::.....
  Fly     2 PAKRSRTFRQSGSALLALLAIILLMNISCTSAARDHRRQTNLEAKVGSH---VVFNCYIDFPFDA 63

  Fly   146 LEPLEIEWYRNSEKLSTWKNVQLDQHRLI----------------------IRQPGSEDDGLYRC 188
            ..|..:.|.::::|:.||...:.....|.                      ||:   .|.|.|.|
  Fly    64 PIPYLVHWTKDNKKIFTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRE---SDQGWYHC 125

  Fly   189 TAS--NAAGRVMSKQGYVYQSSVKCLPRLPRRKNEKMMESWDKQTFLCRGKRGGAAGLEALPAAP 251
            ..|  |.:..|.: .|..|..:|                            :||:  |..:|   
  Fly   126 QVSFPNRSPSVRN-NGTAYHLAV----------------------------QGGS--LIRIP--- 156

  Fly   252 EDLRIVQGPIGQSIIKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSF 316
                    |:.|: |:||:.....|:.:.|     :..|..|.|||.||::|:            
  Fly   157 --------PVNQT-IREGQTAFFHCVMKHP-----ENSQASWYKDGVLLQEVQ------------ 195

  Fly   317 DSGKDALLREDARLVLHKQNGTLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVP 381
                     :..|......:|:||....:.||.|:|:|::: .:...:.::...|.:..:.|.:.
  Fly   196 ---------DLVRRFYMGPDGSLSIDPTMMSDLGEYECKVR-NSDGELQTAKAFLNIQYKAKVIY 250

  Fly   382 QPTSKNLEL-DAVVAKVHCKAQGTPTPQVQWVRDG---ENTTLPDHVEVDANGTLIFRNVNSEHR 442
            .|....|.. ...|...|.:| ..|...::|.:||   ::..:|. |....||:|.|..|:..|.
  Fly   251 APPEVFLPYGQPAVLDCHFRA-NPPLKNLRWEKDGLLFDSYNVPG-VFYKMNGSLFFAKVDENHA 313

  Fly   443 GNYTCLATNSQGQINATVAINVVV--TPKFSVPPVGPIETSEQGTVV-MHCQAI---GDPKPTIQ 501
            |:|||...|..|....:..|:|:|  .|.|||.|.. |...:.|... :.|:||   |:.:|:|.
  Fly   314 GSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKA-IYIQKLGEAAELPCEAIDRDGNNRPSII 377

  Fly   502 WD-KDLKYLSENNTDRERFRFLENGTLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVKTTGDG 565
            |. ||.:.|     ..:||. |..|.|.|..:...|.|.|.|:..|.|.....:.:|::    :.
  Fly   378 WGRKDGQPL-----PADRFS-LSGGNLTITGLVEGDRGIYECSATNEAATITAEAELMI----EN 432

  Fly   566 FAPEESGGDGFLVT---RAVLITMTVALAYIVLVVGLMLWCRYRR--QARKARLNDLSTKEAGGD 625
            .||...    :.:|   ....||:.....|:...:...:|.|...  :.|..|:.|....||...
  Fly   433 IAPRAP----YNLTANSTETCITIRWQPGYLRPNLEYTVWYRLMEAPEWRTLRVLDKKVMEATVQ 493

  Fly   626 --QP-----------DVAGNGKGSEQEPCLSKQHNGHSKSRSKSSGDAQKSDDTACSQQSRASKK 677
              ||           |..|:|..|:|             .|.::.....::||....|..     
  Fly   494 HLQPGKEYEFMVLSQDKYGDGMFSKQ-------------FRFQTLPSPIRADDFDAQQLQ----- 540

  Fly   678 SAHIYEQLALPRSGL 692
              |...|:..|..||
  Fly   541 --HDLGQVTAPAGGL 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046
Ig strand B 133..137 CDD:409353 0/3 (0%)
Ig <135..197 CDD:472250 15/85 (18%)
Ig strand C 150..154 CDD:409353 0/3 (0%)
Ig strand E 171..175 CDD:409353 1/25 (4%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 22/94 (23%)
Ig strand B 272..276 CDD:409571 0/3 (0%)
Ig strand C 290..294 CDD:409571 1/3 (33%)
Ig strand E 337..341 CDD:409571 2/3 (67%)
Ig strand F 351..356 CDD:409571 2/4 (50%)
Ig 395..460 CDD:409353 20/67 (30%)
Ig strand B 395..399 CDD:409353 0/3 (0%)
Ig strand C 408..412 CDD:409353 0/3 (0%)
Ig strand E 430..434 CDD:409353 2/3 (67%)
Ig strand F 444..449 CDD:409353 3/4 (75%)
Ig strand G 457..460 CDD:409353 0/2 (0%)
I-set 468..559 CDD:400151 30/95 (32%)
Ig strand B 486..490 CDD:409570 0/4 (0%)
Ig strand C 499..503 CDD:409570 1/3 (33%)
Ig strand E 525..529 CDD:409570 2/3 (67%)
Ig strand F 539..544 CDD:409570 2/4 (50%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178 3/7 (43%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 15/91 (16%)
Ig strand C 69..72 CDD:409512 0/2 (0%)
Ig strand E 108..112 CDD:409512 0/3 (0%)
Ig strand F 122..127 CDD:409512 2/4 (50%)
Ig 153..242 CDD:472250 26/127 (20%)
Ig strand B 168..172 CDD:409544 0/3 (0%)
Ig strand C 181..185 CDD:409544 1/3 (33%)
Ig strand E 207..211 CDD:409544 2/3 (67%)
Ig strand F 221..226 CDD:409544 2/4 (50%)
Ig strand G 235..238 CDD:409544 0/2 (0%)
Ig_3 247..322 CDD:464046 22/76 (29%)
Ig 341..428 CDD:472250 29/93 (31%)
Ig strand B 359..363 CDD:409353 0/3 (0%)
Ig strand C 375..380 CDD:409353 2/4 (50%)
Ig strand E 396..400 CDD:409353 2/3 (67%)
Ig strand F 410..415 CDD:409353 2/4 (50%)
Ig strand G 423..426 CDD:409353 0/2 (0%)
FN3 435..524 CDD:238020 20/105 (19%)
FN3 554..636 CDD:238020 143/665 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.