DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Fas2

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:424 Identity:105/424 - (24%)
Similarity:160/424 - (37%) Gaps:118/424 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   173 LIIRQPGSEDDGLYRCTASNAAGRVMSKQGYVYQSSVKCLPRLPRRKNEKMMESWDKQTFLCRGK 237
            |:|.....|..|.|.||||.|...::.| |...::.|..              :|..        
  Fly   101 LMITSLSVEMGGKYYCTASYANTEILEK-GVTIKTYVAI--------------TWTN-------- 142

  Fly   238 RGGAAGLEALPAAPEDLRIVQGP-IGQSIIKEGEPTALTCLYELPDELK---NQRIQLRWRKDGK 298
                        |||:    |.| :||..:       :.|      |:|   |..|.  |.::|.
  Fly   143 ------------APEN----QYPTLGQDYV-------VMC------EVKADPNPTID--WLRNGD 176

  Fly   299 LLRQVELGGSAPIPGHSFDSGKDALLREDARLVLHKQNGTLSFASIIASDAGQYQCQLQLEAHAP 363
            .:|..                      .|..:|  :.||.| ..::..||.|.|.|:..:.....
  Fly   177 PIRTT----------------------NDKYVV--QTNGLL-IRNVQESDEGIYTCRAAVIETGE 216

  Fly   364 INSSPGILEVIEQLKFVPQPTSKNLELDAVVAK---VHCKAQGTPTPQVQWVRDGE--NTTLPDH 423
            :......:||..|.:.:..||:    |:||..|   .:|.|:|.|.|::.|:||..  |....|.
  Fly   217 LLERTIRVEVFIQPEIISLPTN----LEAVEGKPFAANCTARGKPVPEISWIRDATQLNVATADR 277

  Fly   424 VEVD-ANGTLIFRNVNSEHRGNYTCLATNSQGQINATVAINVVVTPK-FSVPPVGPIETSEQGTV 486
            .:|: ..|.:...:|:.:..|.|||||.|..|.::....:||:|.|: :.:..|....|.|   :
  Fly   278 FQVNPQTGLVTISSVSQDDYGTYTCLAKNRAGVVDQKTKLNVLVRPQIYELYNVTGARTKE---I 339

  Fly   487 VMHCQAIGDPKPTI--------------QWDKDLKYLSENNTDRERFRFLENGTLEIRNVQVEDE 537
            .:.|:|.|.|.|.|              |.|.|.:.:.|.|.|.||..  ..|||.|.|.:..|:
  Fly   340 AITCRAKGRPAPAITFRRWGTQEEYTNGQQDDDPRIILEPNFDEERGE--STGTLRISNAERSDD 402

  Fly   538 GSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEES 571
            |.|.|...|......:...:.|:     |||:.|
  Fly   403 GLYQCIARNKGADAYKTGHITVE-----FAPDFS 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046
Ig strand B 133..137 CDD:409353
Ig <135..197 CDD:472250 10/23 (43%)
Ig strand C 150..154 CDD:409353
Ig strand E 171..175 CDD:409353 1/1 (100%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 18/97 (19%)
Ig strand B 272..276 CDD:409571 0/3 (0%)
Ig strand C 290..294 CDD:409571 0/3 (0%)
Ig strand E 337..341 CDD:409571 2/3 (67%)
Ig strand F 351..356 CDD:409571 2/4 (50%)
Ig 395..460 CDD:409353 22/70 (31%)
Ig strand B 395..399 CDD:409353 1/6 (17%)
Ig strand C 408..412 CDD:409353 0/3 (0%)
Ig strand E 430..434 CDD:409353 1/3 (33%)
Ig strand F 444..449 CDD:409353 3/4 (75%)
Ig strand G 457..460 CDD:409353 0/2 (0%)
I-set 468..559 CDD:400151 28/105 (27%)
Ig strand B 486..490 CDD:409570 0/3 (0%)
Ig strand C 499..503 CDD:409570 2/17 (12%)
Ig strand E 525..529 CDD:409570 3/3 (100%)
Ig strand F 539..544 CDD:409570 2/4 (50%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178
Fas2NP_001284854.1 Ig 33..121 CDD:472250 9/19 (47%)
Ig strand B 50..54 CDD:409353
Ig strand C 66..70 CDD:409353
Ig strand E 99..103 CDD:409353 1/1 (100%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig 139..209 CDD:472250 26/133 (20%)
Ig strand B 156..159 CDD:409353 0/9 (0%)
Ig strand C 168..172 CDD:409353 1/5 (20%)
Ig strand E 190..194 CDD:409353 3/4 (75%)
Ig strand F 204..209 CDD:409353 2/4 (50%)
IgI_4_MYLK-like 229..319 CDD:409568 28/93 (30%)
Ig strand A 229..232 CDD:409568 1/2 (50%)
Ig strand A' 238..241 CDD:409568 1/6 (17%)
Ig strand B 246..254 CDD:409568 1/7 (14%)
Ig strand C 260..264 CDD:409568 0/3 (0%)
Ig strand C' 267..270 CDD:409568 0/2 (0%)
Ig strand D 277..281 CDD:409568 0/3 (0%)
Ig strand E 285..290 CDD:409568 1/4 (25%)
Ig strand F 298..306 CDD:409568 6/7 (86%)
Ig strand G 309..319 CDD:409568 1/9 (11%)
IG_like 330..424 CDD:214653 27/98 (28%)
Ig strand B 339..343 CDD:409353 0/3 (0%)
Ig strand C 352..356 CDD:409353 1/3 (33%)
Ig strand E 388..394 CDD:409353 3/5 (60%)
Ig strand F 404..409 CDD:409353 2/4 (50%)
Ig 447..515 CDD:409353
Ig strand B 447..451 CDD:409353
Ig strand C 460..464 CDD:409353
Ig strand E 487..491 CDD:409353
Ig strand F 501..506 CDD:409353
FN3 525..619 CDD:238020
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.