DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and robo3

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:XP_005172693.1 Gene:robo3 / 30770 ZFINID:ZDB-GENE-000209-4 Length:1424 Species:Danio rerio


Alignment Length:592 Identity:138/592 - (23%)
Similarity:218/592 - (36%) Gaps:147/592 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SSSRFQRVPQSQSVVENESVKFECESTDSYSELHYDWLHNGHRIAYDK---RVHQI----GSNLH 80
            ::.|....|....|.:.|.....|::....:.: .:|..:|.|:..|:   |.|::    ||...
Zfish    61 AAPRIVEHPSDLIVSKGEPATLNCKAEGRPTPM-VEWYKDGERVETDREDPRSHRMLLPSGSLFF 124

  Fly    81 IEAV--RRTE-DVGNYVCIATNLASGAREASPPAKLSVIYLESASVQ----LLGSNRNELLLKCH 138
            :..|  ||:: |.|.|||:|.|....|  .|..|.|.|..|.....|    ::.:.....:::| 
Zfish   125 LRIVHGRRSKPDEGVYVCVARNYLGEA--VSRNASLEVAILRDDFRQTPSDVVVAAGEPAVMEC- 186

  Fly   139 VEGASGDLEPLEIEWYRNSEKLSTW-KNVQLDQHRLIIRQPGSEDDGLYRCTASNAAGRVMSKQG 202
             ....|..|| .|.|.||:.|::.. :.:.:...:|:|......|.|:|.|..:|..|...|...
Zfish   187 -IPPRGHPEP-TISWKRNNVKVNDKDERITIRGGKLMISNTRKSDAGMYVCVGTNMVGEKDSDPA 249

  Fly   203 --YVYQSSVKCLPRLPRRKNEKMMESWDKQTFLCRGKRGGAAGLEALPAAPEDLRIVQGPIGQSI 265
              .|::.     |...||...:::.:.|...|.|.                     |||      
Zfish   250 ELVVFER-----PMFVRRPVNQVVLADDTVDFQCE---------------------VQG------ 282

  Fly   266 IKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDARL 330
              :..||                  :||:|:           ...:|...|:      :|.|   
Zfish   283 --DPAPT------------------IRWKKE-----------EGELPRGRFE------IRAD--- 307

  Fly   331 VLHKQNGTLSFASIIASDAGQYQCQLQ-----------LEAHAPINSSPGILEVIEQLKFVPQPT 384
                  .:|....:.|.|.|.|.|..:           |:.|...:..|.|         |.:|.
Zfish   308 ------NSLRLTQVKAEDEGSYTCLSENSVGKAEASGSLQVHVGPSLPPQI---------VVRPR 357

  Fly   385 SKNLELDAVVAKVHCKAQGTPTPQVQWVRDGENTTL--------PDHVEVDANGTLIFRNVNSEH 441
            .: :..........|..:|.|.|.|.|.::|....|        .....|..:|.|...:|:||.
Zfish   358 DQ-ISAQGRTVTFLCGTKGNPPPAVFWQKEGSQVLLFPSQPPSQSGRFSVSLSGELTITDVHSED 421

  Fly   442 RGNYTCLATNSQGQINATVAINVVVTPKFSVPPV---GPI-ETSEQGTVV-MHCQAIGDPKPTIQ 501
            .|.|.|.|.:..|.|.....:.|..||...:||:   ||. :|...||.. :.|..:|:|.|:||
Zfish   422 SGYYICQAISVAGSILTKALLEVESTPSDRIPPIIRQGPANQTLAPGTTAQLQCHVMGNPLPSIQ 486

  Fly   502 WDKDLKYLSENNTDRERFRFLENGTLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVKTTGDGF 566
            |::|.:.:...:   ||...:|||||:|..:|..|.|:|.|...:.:|.......|.||      
Zfish   487 WERDGQRILGID---ERISLMENGTLQITALQETDSGAYTCVASSLSGETSWSGVLTVK------ 542

  Fly   567 APEESGG 573
               ||||
Zfish   543 ---ESGG 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 21/77 (27%)
Ig strand B 133..137 CDD:409353 0/3 (0%)
Ig <135..197 CDD:472250 17/62 (27%)
Ig strand C 150..154 CDD:409353 1/3 (33%)
Ig strand E 171..175 CDD:409353 1/3 (33%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 16/105 (15%)
Ig strand B 272..276 CDD:409571 1/3 (33%)
Ig strand C 290..294 CDD:409571 1/3 (33%)
Ig strand E 337..341 CDD:409571 1/3 (33%)
Ig strand F 351..356 CDD:409571 2/4 (50%)
Ig 395..460 CDD:409353 20/72 (28%)
Ig strand B 395..399 CDD:409353 0/3 (0%)
Ig strand C 408..412 CDD:409353 1/3 (33%)
Ig strand E 430..434 CDD:409353 2/3 (67%)
Ig strand F 444..449 CDD:409353 2/4 (50%)
Ig strand G 457..460 CDD:409353 0/2 (0%)
I-set 468..559 CDD:400151 31/95 (33%)
Ig strand B 486..490 CDD:409570 0/4 (0%)
Ig strand C 499..503 CDD:409570 2/3 (67%)
Ig strand E 525..529 CDD:409570 3/3 (100%)
Ig strand F 539..544 CDD:409570 2/4 (50%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178
robo3XP_005172693.1 IgC_1_Robo 63..161 CDD:409490 27/100 (27%)
Ig strand A 63..67 CDD:409490 1/3 (33%)
Ig strand A' 70..75 CDD:409490 0/4 (0%)
Ig strand B 79..87 CDD:409490 1/7 (14%)
Ig strand C 93..98 CDD:409490 1/5 (20%)
Ig strand C' 101..103 CDD:409490 0/1 (0%)
Ig strand D 114..117 CDD:409490 0/2 (0%)
Ig strand E 120..126 CDD:409490 2/5 (40%)
Ig strand F 138..146 CDD:409490 5/7 (71%)
Ig strand G 149..161 CDD:409490 4/13 (31%)
Ig 168..253 CDD:472250 19/87 (22%)
Ig strand B 182..186 CDD:409353 0/3 (0%)
Ig strand C 196..200 CDD:409353 1/3 (33%)
Ig strand E 218..222 CDD:409353 1/3 (33%)
Ig strand F 232..237 CDD:409353 2/4 (50%)
Ig strand G 246..249 CDD:409353 1/2 (50%)
IgI_3_Robo 260..342 CDD:409390 24/154 (16%)
Ig strand A 260..263 CDD:409390 1/2 (50%)
Ig strand A' 265..269 CDD:409390 0/3 (0%)
Ig strand B 272..281 CDD:409390 3/29 (10%)
Ig strand C 287..292 CDD:409390 3/22 (14%)
Ig strand C' 295..298 CDD:409390 0/2 (0%)
Ig strand D 301..306 CDD:409390 1/10 (10%)
Ig strand E 307..314 CDD:409390 2/15 (13%)
Ig strand F 321..329 CDD:409390 3/7 (43%)
Ig strand G 332..342 CDD:409390 1/9 (11%)
Ig 351..444 CDD:472250 23/102 (23%)
Ig strand B 367..371 CDD:409353 0/3 (0%)
Ig strand C 380..384 CDD:409353 1/3 (33%)
Ig strand E 410..414 CDD:409353 2/3 (67%)
Ig strand F 424..429 CDD:409353 2/4 (50%)
Ig strand G 437..440 CDD:409353 0/2 (0%)
Ig 455..541 CDD:472250 28/88 (32%)
Ig strand B 471..475 CDD:409353 0/3 (0%)
Ig strand C 484..488 CDD:409353 2/3 (67%)
Ig strand E 507..511 CDD:409353 3/3 (100%)
Ig strand F 521..526 CDD:409353 2/4 (50%)
FN3 <533..883 CDD:442628 7/23 (30%)
Ig strand G 534..537 CDD:409353 0/2 (0%)
FN3 559..653 CDD:238020
Atrophin-1 1049..>1285 CDD:460830
Herpes_BLLF1 <1178..>1291 CDD:282904
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.