DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Il18r1

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001100375.1 Gene:Il18r1 / 301365 RGDID:1308589 Length:537 Species:Rattus norvegicus


Alignment Length:405 Identity:94/405 - (23%)
Similarity:144/405 - (35%) Gaps:109/405 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 IKEGEPTAL-TCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDAR 329
            :.||||..| .|....|.. .|:...:||.|           |:|   .|.:   ::..:|...|
  Rat    30 VVEGEPFYLKPCDMSAPMH-NNETATMRWFK-----------GNA---SHGY---RELNMRSSPR 76

  Fly   330 LVLHKQNGTLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPTSKNLELDAVV 394
            :..|  ...|.|..:...|.|.|..|:..:                         .:|..|:...
  Rat    77 IAFH--GHALEFWPVELEDKGTYFSQVGND-------------------------RQNWTLNVTK 114

  Fly   395 AKVH-CKAQGTPTPQVQWVRDG-----ENTTLPDHVEVDANGTLIFRNVNSEHR----------- 442
            ...| |.::...|.:...|:..     ||   |.:.|: .|.||:::|.....:           
  Rat   115 RNKHSCFSEKLVTNRDVEVKKSLWITCEN---PSYGEL-INHTLLYKNCKEISKTPMILKDAEFG 175

  Fly   443 --GNYTCLAT---NSQGQINATVAINVVV-------TPKF---SVPPVGPIETSEQGTVVMHCQA 492
              |.|:|:.:   |.| |.|.|..:|:.|       ||..   ....|| :|..|.  |.::|.|
  Rat   176 DEGYYSCVFSVHHNGQ-QYNITKTVNITVIEGNSKITPAIFGSKSAKVG-VELGED--VELNCSA 236

  Fly   493 IGDPKPTIQWD-KDLKYLSEN-NTDRERFRFLENGTL---EIRNVQVEDEG----SYGCTIGNSA 548
            :.:......|. :....|..| :.||....:...|.|   :|..:|...|.    .|.||:.|..
  Rat   237 VLNRNDLFYWSIRKEDSLDPNVHEDRNETTWTFEGKLHASKILRIQKVTEKYLNVLYNCTVANEE 301

  Fly   549 GLKREDVQLVVKTTGDGFAPEESGGDGFL--VTRAVLITMT---VALAYIVLVVGLMLWCRYRRQ 608
            ....:...||.|.|.|      ..|..|:  :|..||.::.   |.:..|:..|.|:|:  |||.
  Rat   302 ATDTKSFILVRKETPD------IQGHVFMRGITMVVLTSVAAVCVVILCIIYKVDLVLF--YRRV 358

  Fly   609 A-RKARLNDLSTKEA 622
            | |...|.|..|.:|
  Rat   359 AERDETLTDGKTYDA 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845 23/105 (22%)
Ig 395..460 CDD:143165 19/86 (22%)
I-set 468..559 CDD:254352 23/102 (23%)
IGc2 484..549 CDD:197706 17/73 (23%)
PTK_CCK4 686..1026 CDD:133178
STYKc 692..1020 CDD:214568
Il18r1NP_001100375.1 Ig_2 22..112 CDD:290606 25/126 (20%)
Ig <156..205 CDD:299845 11/49 (22%)
IG_like 224..310 CDD:214653 19/87 (22%)
TIR 370..519 CDD:214587 2/4 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.