DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Cfp

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001100227.1 Gene:Cfp / 299314 RGDID:1594557 Length:465 Species:Rattus norvegicus


Alignment Length:178 Identity:31/178 - (17%)
Similarity:57/178 - (32%) Gaps:65/178 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   832 LEYTDWGDLKQFLLATAGKVNTATAGSSSPPPLTTSQVLAVAYQIARGMDAIYRAR-FTHRDLAT 895
            ::...|..|...:|.|.|          |.|.|..:|     |:...|     |.: ...||:..
  Rat     5 MQAPQWLLLLLLILPTTG----------SDPVLCFTQ-----YEEPSG-----RCKGLLGRDIRV 49

  Fly   896 RNCVISSEFIVKVSYPALCKDKYSREYHKHRNTLLPIRWLAPECIQEDEYTTKSDIFAYGVVVWE 960
            .:|.:::.:..:.....||:...|.:            |.|                      |.
  Rat    50 EDCCLNTAYAFQEHDGGLCQSCRSPQ------------WSA----------------------WS 80

  Fly   961 LF-------NQATKLPHEELTNE--QVVQRSQAGSLEWSVAEATPDSL 999
            .:       ::.::|.|......  |..:::..|:|||.: :|..|.|
  Rat    81 SWGPCSVTCSEGSQLRHRRCVGRGGQCSEKAAPGTLEWQL-QACEDQL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845
Ig 395..460 CDD:143165
I-set 468..559 CDD:254352
IGc2 484..549 CDD:197706
PTK_CCK4 686..1026 CDD:133178 31/178 (17%)
STYKc 692..1020 CDD:214568 31/178 (17%)
CfpNP_001100227.1 TSP_1 77..128 CDD:278517 12/74 (16%)
TSP_1 136..184 CDD:278517
TSP1 192..251 CDD:214559
TSP_1 257..303 CDD:278517
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.