DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and NPTN

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_036560.1 Gene:NPTN / 27020 HGNCID:17867 Length:398 Species:Homo sapiens


Alignment Length:428 Identity:96/428 - (22%)
Similarity:161/428 - (37%) Gaps:144/428 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SICGLVMALMMASVL-----ASSSRFQRVPQSQSVVENESVKFECESTDS--------YSELH-- 56
            |...|.:.|:..|:|     |.::.|.:.|.|::.:..::.:..|:...|        |:|::  
Human     8 SALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWWYAEVNRA 72

  Fly    57 --YDWLHNGHRIAYDKRV---HQIGSNLHIEAVRRT----EDVGNYVCIATN--LASGAREASP- 109
              :..|.:|.|   .:||   ...||| .:..:|.|    ||.|.|.|.|:|  ..:..|: :| 
Human    73 ESFRQLWDGAR---KRRVTVNTAYGSN-GVSVLRITRLTLEDSGTYECRASNDPKRNDLRQ-NPS 132

  Fly   110 ------PAKLSVI----YLESASVQLLGSNRNELLLKCHVEGASGDLEPLEIEWYRNSEKLS-TW 163
                  .|.:||:    .:.|..|.:..|....:.|:|::..:|..|  ....|.:|..:|| |.
Human   133 ITWIRAQATISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTL--TYSYWTKNGVELSATR 195

  Fly   164 KNVQLDQHRLIIRQPGSEDDGLYRCTASNAAGRVMSKQGYVYQSSVKCLPRLPRRKNEKMMESWD 228
            ||....::|  |.:|.:||.|.|.|.             |.:.|:.|                  
Human   196 KNASNMEYR--INKPRAEDSGEYHCV-------------YHFVSAPK------------------ 227

  Fly   229 KQTFLCRGKRGGAAGLEALPAAPEDLRIVQGPIGQSIIKEGEPTALTCL---YELPDELKNQRIQ 290
                       ..|.:| :.|||:    :.|........||:...:.|.   |..||.:      
Human   228 -----------ANATIE-VKAAPD----ITGHKRSENKNEGQDATMYCKSVGYPHPDWI------ 270

  Fly   291 LRWRK--DGKLLRQVELGGSAPIPGHSFDSGKDALLREDARLVLHKQNGT-LSFASI-IASDAGQ 351
              |||  :|..:..|...|..                    .:::|:|.| |:..:: |..|.|:
Human   271 --WRKKENGMPMDIVNTSGRF--------------------FIINKENYTELNIVNLQITEDPGE 313

  Fly   352 YQCQ-------------LQLEAH-APINSSPGIL-EVI 374
            |:|.             |::.:| ||:....||| |:|
Human   314 YECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEII 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 22/86 (26%)
Ig strand B 133..137 CDD:409353 1/3 (33%)
Ig <135..197 CDD:472250 19/62 (31%)
Ig strand C 150..154 CDD:409353 0/3 (0%)
Ig strand E 171..175 CDD:409353 1/3 (33%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 22/114 (19%)
Ig strand B 272..276 CDD:409571 0/3 (0%)
Ig strand C 290..294 CDD:409571 0/3 (0%)
Ig strand E 337..341 CDD:409571 2/4 (50%)
Ig strand F 351..356 CDD:409571 2/17 (12%)
Ig 395..460 CDD:409353
Ig strand B 395..399 CDD:409353
Ig strand C 408..412 CDD:409353
Ig strand E 430..434 CDD:409353
Ig strand F 444..449 CDD:409353
Ig strand G 457..460 CDD:409353
I-set 468..559 CDD:400151
Ig strand B 486..490 CDD:409570
Ig strand C 499..503 CDD:409570
Ig strand E 525..529 CDD:409570
Ig strand F 539..544 CDD:409570
Ig strand G 552..555 CDD:409570
PTK_CCK4 686..1026 CDD:133178
NPTNNP_036560.1 Ig 31..146 CDD:472250 29/119 (24%)
Ig strand B 48..52 CDD:409353 0/3 (0%)
Ig strand C 61..65 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 0/3 (0%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig strand G 137..140 CDD:409353 0/2 (0%)
Narpin, mediates binding with FGFR1 and has antidepressant-like activity. /evidence=ECO:0000250 149..161 2/11 (18%)
Ig 168..219 CDD:472250 18/54 (33%)
Ig strand C 180..185 CDD:409353 0/4 (0%)
Ig strand E 201..205 CDD:409353 1/5 (20%)
Ig strand F 215..219 CDD:409353 1/3 (33%)
Ig 250..333 CDD:472250 22/110 (20%)
Ig strand B 255..259 CDD:409570 0/3 (0%)
Ig strand C 268..274 CDD:409570 3/13 (23%)
Ig strand E 297..302 CDD:409570 2/4 (50%)
Ig strand F 313..318 CDD:409570 2/4 (50%)
Ig strand G 326..329 CDD:409570 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..398
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.