DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Siglec1

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:XP_036015809.1 Gene:Siglec1 / 20612 MGIID:99668 Length:1719 Species:Mus musculus


Alignment Length:571 Identity:126/571 - (22%)
Similarity:192/571 - (33%) Gaps:194/571 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SQSVVENESVKFECESTDSYS-ELHYDWLHNGHRIAYDKRVHQIGSNLHIEAVRRTEDVGNYVCI 96
            |..|||.::|...|.|..|.: :..:.|..||..:     :....|:|.:.|...| |.|:|.| 
Mouse   525 SAEVVEGQAVTLSCRSGLSPAPDTRFSWYLNGALL-----LEGSSSSLLLPAASST-DAGSYYC- 582

  Fly    97 ATNLASGAREASP--PAKLSVIY------------LESASVQLLGSNRNELLLKCHVEGASGDLE 147
              ...:|...:.|  |..|:|.|            |:::.|   |..|..:|| |||:..    .
Mouse   583 --RTQAGPNTSGPSLPTVLTVFYPPRKPTFTARLDLDTSGV---GDGRRGILL-CHVDSD----P 637

  Fly   148 PLEIEWYRNSE-----------------KLSTWKNVQLDQHRLIIRQPGSEDDGLYRCTASNAAG 195
            |.::.......                 |:|...|    ...:.|::|..||:|:|.|.|||..|
Mouse   638 PAQLRLLHKGHVVATSLPSRCGSCSQRTKVSRTSN----SLHVEIQKPVLEDEGVYLCEASNTLG 698

  Fly   196 RVMSKQGYVYQSSVKCLPRLPRRKNEKMMESWDKQTFLCRGKRGGAAGLEALPAAPEDLRIVQGP 260
            ...:...:..:::|                                              :|..|
Mouse   699 NSSAAASFNAKATV----------------------------------------------LVITP 717

  Fly   261 IGQSIIKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLR 325
              .:.::||....|||  .:..|:........|.::|.|..|..|                    
Mouse   718 --SNTLREGTEANLTC--NVNQEVAVSPANFSWFRNGVLWTQGSL-------------------- 758

  Fly   326 EDARLVLHKQNGTLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPTSKNLEL 390
            |..||           ..:..:||..|.|:|..|..|.: |:|.:|.|:    :.|.|...:..|
Mouse   759 ETVRL-----------QPVARTDAAVYACRLLTEDGAQL-SAPVVLSVL----YAPDPPKLSALL 807

  Fly   391 DAVVAKVH-----CKAQGTPTPQVQWVRDGEN---TTL----PDHVEVDANGT-----LIFRNVN 438
            |  |.:.|     |.....|...:...| |::   |.|    |.|..:.|..|     |..|.:.
Mouse   808 D--VGQGHMAVFICTVDSYPLAHLSLFR-GDHLLATNLEPQRPSHGRIQAKATANSLQLEVRELG 869

  Fly   439 SEHRGNYTCLATNSQGQINATVAIN-----VVVTPKFSVPPVGPIETSEQGTVVMHCQAIGDPKP 498
            ....|||.|.|||..|..|:::...     |.|:|       .| |..|...||:.||.     |
Mouse   870 LVDSGNYHCEATNILGSANSSLFFQVRGAWVQVSP-------SP-ELREGQAVVLSCQV-----P 921

  Fly   499 T-------IQWDKDLKYLSENNTDRERFRFLENGTLEIRNVQVEDEGSYGC 542
            |       ..|.:|.:.|.|:.          :.||.|..:.:...|:|.|
Mouse   922 TGVSEGTSYSWYQDGRPLQEST----------SSTLRIAAISLRQAGAYHC 962

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352 23/84 (27%)
Ig 31..115 CDD:299845 23/84 (27%)
IGc2 133..195 CDD:197706 19/78 (24%)
Ig 268..373 CDD:299845 24/104 (23%)
Ig 395..460 CDD:143165 22/81 (27%)
I-set 468..559 CDD:254352 20/82 (24%)
IGc2 484..549 CDD:197706 16/66 (24%)
PTK_CCK4 686..1026 CDD:133178
STYKc 692..1020 CDD:214568
Siglec1XP_036015809.1 IgV_CD33 27..134 CDD:409377
Ig strand B 43..47 CDD:409377
Ig strand C 62..66 CDD:409377
Ig strand E 104..108 CDD:409377
Ig strand F 118..123 CDD:409377
C2-set_2 148..235 CDD:400489
Ig strand A 148..153 CDD:409353
Ig strand B 161..169 CDD:409353
Ig strand C 178..184 CDD:409353
Ig strand D 193..199 CDD:409353
Ig strand E 203..212 CDD:409353
Ig strand G 231..239 CDD:409353
Ig strand A 245..253 CDD:409353
Ig strand A' 257..261 CDD:409353
IGc2 261..319 CDD:197706
Ig strand B 262..272 CDD:409353
Ig strand C 279..285 CDD:409353
Ig strand C' 287..290 CDD:409353
Ig strand E 296..301 CDD:409353
Ig strand F 308..316 CDD:409353
Ig strand G 319..330 CDD:409353
Ig 334..417 CDD:416386
Ig strand A' 342..345 CDD:409353
Ig strand B 346..356 CDD:409353
Ig strand C 363..369 CDD:409353
Ig strand C' 371..374 CDD:409353
Ig strand E 380..386 CDD:409353
Ig strand F 393..401 CDD:409353
Ig strand G 404..417 CDD:409353
Ig strand A' 412..415 CDD:409353
Ig 428..511 CDD:416386
Ig strand B 436..443 CDD:409353
Ig strand C 449..454 CDD:409353
Ig strand C' 456..458 CDD:409353
Ig strand D 471..477 CDD:409353
Ig strand E 480..486 CDD:409353
Ig strand F 494..502 CDD:409353
Ig_3 523..583 CDD:404760 19/66 (29%)
IG 624..702 CDD:214652 21/86 (24%)
Ig_3 712..777 CDD:404760 20/145 (14%)
Ig strand A' 720..723 CDD:409353 0/2 (0%)
Ig strand B 724..734 CDD:409353 4/11 (36%)
Ig strand C 742..748 CDD:409353 1/5 (20%)
Ig strand C' 750..753 CDD:409353 1/2 (50%)
Ig strand E 759..765 CDD:409353 3/16 (19%)
Ig strand F 772..780 CDD:409353 3/7 (43%)
Ig strand G 783..796 CDD:409353 5/17 (29%)
Ig 815..895 CDD:416386 21/80 (26%)
Ig strand B 815..819 CDD:409353 0/3 (0%)
Ig strand C 828..832 CDD:409353 0/3 (0%)
Ig strand E 861..865 CDD:409353 1/3 (33%)
Ig strand F 875..880 CDD:409353 3/4 (75%)
Ig 900..975 CDD:416386 22/86 (26%)
Ig strand A' 907..910 CDD:409353 1/2 (50%)
Ig strand B 911..921 CDD:409353 4/14 (29%)
Ig strand C 928..934 CDD:409353 1/5 (20%)
Ig strand C' 936..939 CDD:409353 0/2 (0%)
Ig strand E 945..951 CDD:409353 3/5 (60%)
Ig strand F 958..968 CDD:409353 3/5 (60%)
Ig strand G 971..984 CDD:409353
IG_like 1005..1093 CDD:214653
Ig strand C 1026..1031 CDD:409353
Ig strand C' 1033..1035 CDD:409353
Ig strand D 1042..1048 CDD:409353
Ig strand E 1051..1057 CDD:409353
Ig strand F 1065..1073 CDD:409353
Ig_2 1095..1167 CDD:404734
Ig strand A' 1095..1100 CDD:409353
Ig strand B 1105..1114 CDD:409353
Ig strand C 1121..1126 CDD:409353
Ig strand C' 1128..1131 CDD:409353
Ig strand E 1133..1138 CDD:409353
Ig strand F 1148..1156 CDD:409353
Ig strand G 1160..1170 CDD:409353
IG_like 1195..1258 CDD:214653
Ig strand C 1204..1208 CDD:409353
Ig strand E 1226..1230 CDD:409353
Ig strand F 1240..1245 CDD:409353
Ig 1265..1344 CDD:416386
Ig strand A' 1271..1274 CDD:409353
Ig strand B 1278..1284 CDD:409353
Ig strand C 1294..1299 CDD:409353
Ig strand C' 1301..1303 CDD:409353
Ig strand E 1309..1314 CDD:409353
Ig strand F 1322..1327 CDD:409353
Ig strand G 1338..1344 CDD:409353
Ig <1365..1440 CDD:416386
Ig strand B 1365..1372 CDD:409353
Ig strand C 1378..1383 CDD:409353
Ig strand C' 1386..1388 CDD:409353
Ig strand D 1394..1407 CDD:409353
Ig strand E 1409..1415 CDD:409353
Ig strand F 1424..1432 CDD:409353
Ig_3 1450..1517 CDD:404760
Ig strand B 1555..1561 CDD:409353
Ig <1556..1630 CDD:416386
Ig strand C 1566..1571 CDD:409353
Ig strand C' 1573..1575 CDD:409353
Ig strand D 1592..1596 CDD:409353
Ig strand E 1599..1603 CDD:409353
Ig strand F 1613..1621 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.