DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Nptn

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_001392991.1 Gene:Nptn / 20320 MGIID:108077 Length:397 Species:Mus musculus


Alignment Length:467 Identity:103/467 - (22%)
Similarity:172/467 - (36%) Gaps:145/467 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 GAAGLEAL---------PAAPEDLRIVQGPIGQSIIKEGEPTALTCLYELPDELKNQRIQLRW-- 293
            ||..|..|         |.|.::...|:.|:.::.: .|:...|.|     |.:.:...:::|  
Mouse     8 GALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKL-TGDAFELYC-----DVVGSPTPEIQWWY 66

  Fly   294 ---------RK--DGKLLRQVELGGSAPIPGHSFDSGKDALLREDARLVLHKQNGTLSFASIIAS 347
                     |:  ||...|:|.:       ..::.|...::|| ..||.|              .
Mouse    67 AEVNRAESFRQLWDGARKRRVTV-------NTAYGSNGVSVLR-ITRLTL--------------E 109

  Fly   348 DAGQYQCQLQLE-AHAPINSSPGI--------LEVIEQLKFVPQPTSKNLELDAVVAKVHCKAQG 403
            |:|.|:|:...: ....:..:|.|        :.|:::.:.|   ||:.:.:...:..|..:...
Mouse   110 DSGTYECRASNDPKRNDLRQNPSITWIRAQATISVLQKPRIV---TSEEVIIRESLLPVTLQCNL 171

  Fly   404 TPTPQV----QWVRDGENTTLPDHVEVDA---NGTLIFRNVN---SEHRGNYTCL-ATNSQGQIN 457
            |.:...    .|.|:|        ||:.|   |.:.:...:|   :|..|.|.|: ...|..:.|
Mouse   172 TSSSHTLMYSYWTRNG--------VELTATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKAN 228

  Fly   458 ATVAINVVVTPKFSVPPVGPIETSEQGT----VVMHCQAIGDPKPTIQWDKDLKYLSENNTDRE- 517
            ||:.:.       :.|.:...:.||...    .:|:|:::|.|.|...|.|     .||....| 
Mouse   229 ATIEVK-------AAPDITGHKRSENKNEGQDAMMYCKSVGYPHPEWIWRK-----KENGVFEEI 281

  Fly   518 -----RFRFL---ENGT-LEIRNVQV-EDEGSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEESG 572
                 || |:   ||.| |.|.|:|: ||.|.|.|...||.|.......|.|::......|    
Mouse   282 SNSSGRF-FITNKENYTELSIVNLQITEDPGEYECNATNSIGSASVSTVLRVRSHLAPLWP---- 341

  Fly   573 GDGFLVTRAVLITMTVALAYIVLVVGLMLWCRYRRQARKARLNDLSTKEAGGDQPDVAGNGKGSE 637
               ||...|.:|.:.|     ::||       |.::.|...:.|       .|:|  ||      
Mouse   342 ---FLGILAEIIILVV-----IIVV-------YEKRKRPDEVPD-------DDEP--AG------ 376

  Fly   638 QEPCLSKQHNGH 649
              |..:...|.|
Mouse   377 --PMKTNSTNNH 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046
Ig strand B 133..137 CDD:409353
Ig <135..197 CDD:472250
Ig strand C 150..154 CDD:409353
Ig strand E 171..175 CDD:409353
Ig strand F 185..190 CDD:409353
Ig 265..360 CDD:472250 20/108 (19%)
Ig strand B 272..276 CDD:409571 1/3 (33%)
Ig strand C 290..294 CDD:409571 1/14 (7%)
Ig strand E 337..341 CDD:409571 0/3 (0%)
Ig strand F 351..356 CDD:409571 2/4 (50%)
Ig 395..460 CDD:409353 17/75 (23%)
Ig strand B 395..399 CDD:409353 1/3 (33%)
Ig strand C 408..412 CDD:409353 0/7 (0%)
Ig strand E 430..434 CDD:409353 0/3 (0%)
Ig strand F 444..449 CDD:409353 2/5 (40%)
Ig strand G 457..460 CDD:409353 2/2 (100%)
I-set 468..559 CDD:400151 32/105 (30%)
Ig strand B 486..490 CDD:409570 1/3 (33%)
Ig strand C 499..503 CDD:409570 0/3 (0%)
Ig strand E 525..529 CDD:409570 2/4 (50%)
Ig strand F 539..544 CDD:409570 2/4 (50%)
Ig strand G 552..555 CDD:409570 0/2 (0%)
PTK_CCK4 686..1026 CDD:133178
NptnNP_001392991.1 Ig 31..146 CDD:472250 25/142 (18%)
Ig strand B 48..52 CDD:409353 1/3 (33%)
Ig strand C 61..65 CDD:409353 0/3 (0%)
Ig strand E 99..103 CDD:409353 2/4 (50%)
Ig strand F 113..118 CDD:409353 2/4 (50%)
Ig strand G 137..140 CDD:409353 0/2 (0%)
Narpin, mediates binding with FGFR1 and has antidepressant-like activity. /evidence=ECO:0000250 149..161 3/14 (21%)
Ig 167..218 CDD:472250 12/58 (21%)
Ig strand C 179..184 CDD:409353 0/4 (0%)
Ig strand E 200..204 CDD:409353 0/3 (0%)
Ig strand F 214..218 CDD:409353 1/3 (33%)
Ig 249..332 CDD:472250 29/88 (33%)
Ig strand B 254..258 CDD:409353 1/3 (33%)
Ig strand C 267..273 CDD:409353 2/10 (20%)
Ig strand E 297..301 CDD:409353 2/3 (67%)
Ig strand F 312..317 CDD:409353 2/4 (50%)
Ig strand G 325..328 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..397 9/40 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.