DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and zig-11

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_503523.2 Gene:zig-11 / 189580 WormBaseID:WBGene00021305 Length:304 Species:Caenorhabditis elegans


Alignment Length:163 Identity:42/163 - (25%)
Similarity:66/163 - (40%) Gaps:43/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ETNDPTVPRCSVTTFLHRI--AFTVLHASFFLENKNG------REEEQQTINKYNSLNYVTERIL 64
            ::.||....| :.|.||||  .|.| |..|..::.|.      .|.|     |:|.:....| ||
 Worm   240 DSEDPRERDC-LKTILHRIYGKFMV-HRPFIRKSINNIFYRFVFETE-----KHNGIAEFLE-IL 296

  Fly    65 ASTLPARRLQNGSSSPHAPNGTPPVDEHERELINMLEQKHKQNYRILDLEARLVNITLEKLCEL- 128
            .|.:      ||.:       .|..|||:..|:.:|...||.  :.|.:..:.::..:.:..|. 
 Worm   297 GSII------NGFA-------LPLKDEHKVFLVRVLIPLHKP--KCLQMYHQQLSYCITQFVEKD 346

  Fly   129 CKYIDS--------W--LGSGKEKIVVLQDRED 151
            ||..|:        |  ..|.|| ::.|.:.|:
 Worm   347 CKLADTVIRGLLKYWPVTNSSKE-VMFLNELEE 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046 18/73 (25%)
Ig strand B 133..137 CDD:409353 2/13 (15%)
Ig <135..197 CDD:472250 6/19 (32%)
Ig strand C 150..154 CDD:409353 1/2 (50%)
Ig strand E 171..175 CDD:409353
Ig strand F 185..190 CDD:409353
Ig 265..360 CDD:472250
Ig strand B 272..276 CDD:409571
Ig strand C 290..294 CDD:409571
Ig strand E 337..341 CDD:409571
Ig strand F 351..356 CDD:409571
Ig 395..460 CDD:409353
Ig strand B 395..399 CDD:409353
Ig strand C 408..412 CDD:409353
Ig strand E 430..434 CDD:409353
Ig strand F 444..449 CDD:409353
Ig strand G 457..460 CDD:409353
I-set 468..559 CDD:400151
Ig strand B 486..490 CDD:409570
Ig strand C 499..503 CDD:409570
Ig strand E 525..529 CDD:409570
Ig strand F 539..544 CDD:409570
Ig strand G 552..555 CDD:409570
PTK_CCK4 686..1026 CDD:133178
zig-11NP_503523.2 Ig 166..225 CDD:472250
Ig strand B 168..172 CDD:409353
Ig strand C 181..185 CDD:409353
Ig strand E 202..206 CDD:409353
Ig strand F 216..221 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.