DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and zig-12

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_509485.1 Gene:zig-12 / 181123 WormBaseID:WBGene00019727 Length:197 Species:Caenorhabditis elegans


Alignment Length:209 Identity:49/209 - (23%)
Similarity:81/209 - (38%) Gaps:54/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 PQPTSKN--LELDAVVAKVHCKAQGTPTPQVQWVRDGENTTLPDHVEVDANGTLIFRNVNSEHRG 443
            |:..|:|  :.|:.:|.       |....::||...      ||  |::.|..|.|.  ||:..|
 Worm    10 PKIRSENGSVFLEVIVT-------GADVSKIQWFFG------PD--ELEENEFLKFS--NSDEGG 57

  Fly   444 N------------------YTCLATNSQGQINATVAINVVVTPKFSVPPVGPIETSEQGTVV--- 487
            |                  |..:..|:.|:.::...:.....|.|...|  .|...:.|.|:   
 Worm    58 NRTKFVAEIKDFDKPLAGEYKAVFANADGENSSNFTVAAGNAPDFHDKP--HIVQRDNGNVIVIK 120

  Fly   488 --------MHCQAIGDPKPTIQWDKDLKYLSENNTDRERFRFLENGTLEIRNVQVEDEGSYGCTI 544
                    |..:...|.||....|:....:.:::.|::.|:||    |||...|.:||..|.|.:
 Worm   121 VRAKSHLEMKAEWFKDEKPVKFTDRVKAVVKKDDKDKDGFQFL----LEITGPQKDDEAKYKCVV 181

  Fly   545 GNSAGLKREDVQLV 558
            .||.|..::.:.||
 Worm   182 KNSEGQNQQALNLV 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845
Ig 395..460 CDD:143165 16/82 (20%)
I-set 468..559 CDD:254352 28/102 (27%)
IGc2 484..549 CDD:197706 21/75 (28%)
PTK_CCK4 686..1026 CDD:133178
STYKc 692..1020 CDD:214568
zig-12NP_509485.1 PHA03273 <39..>143 CDD:223031 23/109 (21%)
Ig 100..194 CDD:386229 26/99 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4475
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.