| Sequence 1: | NP_523705.2 | Gene: | otk / 36283 | FlyBaseID: | FBgn0004839 | Length: | 1033 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_598259.2 | Gene: | Il1rl2 / 171106 | RGDID: | 621782 | Length: | 561 | Species: | Rattus norvegicus |
| Alignment Length: | 437 | Identity: | 83/437 - (18%) |
|---|---|---|---|
| Similarity: | 148/437 - (33%) | Gaps: | 145/437 - (33%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 265 IIKEGEPTALTCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDAR 329
Fly 330 LVLHKQNGTLSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPTSKNLELDAVV 394
Fly 395 AKVH-CKAQ------GTPTPQVQWVRDGENTTL------PDHVEVDA------------------ 428
Fly 429 NGT-LIFRNVNSEHRGNYTCLATNSQ-GQINAT---VAINVVVT------PKFSVPPVGPIETSE 482
Fly 483 QGTVVMHCQAIGDPKPTIQWDKDLKYLSENNT-------DRERFRFLENGTLEIRN--------- 531
Fly 532 ---VQVEDEG-SYGCTIGNSAGLKREDVQLVVKTTGDGFAPEESGGDGFLVTRAVLITMTVALAY 592
Fly 593 IVLVVGLMLWCR--------------------YRRQARKARLNDLST 619 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| otk | NP_523705.2 | I-set | 26..115 | CDD:254352 | |
| Ig | 31..115 | CDD:299845 | |||
| IGc2 | 133..195 | CDD:197706 | |||
| Ig | 268..373 | CDD:299845 | 20/104 (19%) | ||
| Ig | 395..460 | CDD:143165 | 19/100 (19%) | ||
| I-set | 468..559 | CDD:254352 | 26/110 (24%) | ||
| IGc2 | 484..549 | CDD:197706 | 21/84 (25%) | ||
| PTK_CCK4 | 686..1026 | CDD:133178 | |||
| STYKc | 692..1020 | CDD:214568 | |||
| Il1rl2 | NP_598259.2 | Ig | 26..115 | CDD:416386 | 21/129 (16%) |
| Ig strand A' | 31..35 | CDD:409353 | 0/1 (0%) | ||
| Ig strand B | 39..44 | CDD:409353 | 1/4 (25%) | ||
| Ig strand C | 55..59 | CDD:409353 | 2/23 (9%) | ||
| Ig strand C' | 64..66 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 74..78 | CDD:409353 | 2/5 (40%) | ||
| Ig strand E | 80..84 | CDD:409353 | 0/3 (0%) | ||
| Ig strand F | 93..101 | CDD:409353 | 4/8 (50%) | ||
| Ig strand G | 104..115 | CDD:409353 | 0/10 (0%) | ||
| Ig | 133..222 | CDD:416386 | 19/88 (22%) | ||
| Ig strand A | 135..140 | CDD:409353 | 2/4 (50%) | ||
| Ig strand B | 145..149 | CDD:409353 | 1/3 (33%) | ||
| Ig strand C | 161..166 | CDD:409353 | 0/4 (0%) | ||
| Ig strand C' | 169..171 | CDD:409353 | 0/1 (0%) | ||
| Ig strand D | 176..180 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 182..187 | CDD:409353 | 2/4 (50%) | ||
| Ig strand F | 196..205 | CDD:409353 | 3/8 (38%) | ||
| Ig strand G | 208..221 | CDD:409353 | 3/12 (25%) | ||
| Ig | 230..330 | CDD:416386 | 26/110 (24%) | ||
| Ig strand A | 230..233 | CDD:409353 | 1/2 (50%) | ||
| Ig strand A' | 238..241 | CDD:409353 | 0/2 (0%) | ||
| Ig strand B | 246..255 | CDD:409353 | 2/9 (22%) | ||
| Ig strand C | 262..268 | CDD:409353 | 1/5 (20%) | ||
| Ig strand C' | 270..273 | CDD:409353 | 2/2 (100%) | ||
| Ig strand E | 296..303 | CDD:409353 | 0/6 (0%) | ||
| Ig strand G | 322..330 | CDD:409353 | 3/13 (23%) | ||
| TIR | 389..539 | CDD:396246 | 4/18 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||