DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and Bsg

DIOPT Version :10

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_033898.1 Gene:Bsg / 12215 MGIID:88208 Length:389 Species:Mus musculus


Alignment Length:390 Identity:83/390 - (21%)
Similarity:126/390 - (32%) Gaps:165/390 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 LLLKCHVEGASGDLEPL-EIEWY-----RNSEKLSTWKNVQLD---------QH---RLIIRQPG 179
            ::|.|...|:     |: ||:|:     .|......|...:||         ||   .|.:....
Mouse    40 VVLHCEAVGS-----PIPEIQWWFEGNAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLT 99

  Fly   180 SEDDGLYRCTASNAAGRVMSKQGYVYQSSVKCLPRLPRRKNEKMMESWDKQTFLCRGKRGGAAGL 244
            :||.|.|.|.||:...|             ..|.|.||.|       |         .|..|:.:
Mouse   100 AEDTGTYECRASSDPDR-------------NHLTRPPRVK-------W---------VRAQASVV 135

  Fly   245 EALPAAPEDLRIVQGPIGQSIIKEGEPTALTCLYELPDELKNQRIQL---RWRKDGKLLRQVELG 306
            ...|          |.|..|:.:....|.|||      .|.:..:.:   ||.:.||        
Mouse   136 VLEP----------GTIQTSVQEVNSKTQLTC------SLNSSGVDIVGHRWMRGGK-------- 176

  Fly   307 GSAPIPGHSFDSGKDALLREDARLVLHKQNGTLSFASIIASD--AGQYQCQLQLEAHAPINSSPG 369
                            :|:||....||.:       .|:.:|  :|:|.|               
Mouse   177 ----------------VLQEDTLPDLHTK-------YIVDADDRSGEYSC--------------- 203

  Fly   370 ILEVIEQLKFVPQPTSK---NLE--------------LDAVVAKVHCKAQGTPTPQVQWV----- 412
                    .|:|:|..:   |:|              .:..:||:.||:..:..|...|.     
Mouse   204 --------IFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTS 260

  Fly   413 RDGENTTLPDHVEVDANG-------------TLIFRNVNSEHRGNYTCLATNSQGQINATVAINV 464
            ..||...:.:..|  |||             |:...:||.: .|.|.|.|||:||....|:::.|
Mouse   261 DTGEEEAITNSTE--ANGKYVVVSTPEKSQLTISNLDVNVD-PGTYVCNATNAQGTTRETISLRV 322

  Fly   465  464
            Mouse   323  322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 Ig_3 31..99 CDD:464046
Ig strand B 133..137 CDD:409353 1/3 (33%)
Ig <135..197 CDD:472250 21/79 (27%)
Ig strand C 150..154 CDD:409353 2/3 (67%)
Ig strand E 171..175 CDD:409353 2/6 (33%)
Ig strand F 185..190 CDD:409353 2/4 (50%)
Ig 265..360 CDD:472250 19/99 (19%)
Ig strand B 272..276 CDD:409571 2/3 (67%)
Ig strand C 290..294 CDD:409571 1/6 (17%)
Ig strand E 337..341 CDD:409571 0/3 (0%)
Ig strand F 351..356 CDD:409571 2/4 (50%)
Ig 395..460 CDD:409353 23/82 (28%)
Ig strand B 395..399 CDD:409353 2/3 (67%)
Ig strand C 408..412 CDD:409353 0/3 (0%)
Ig strand E 430..434 CDD:409353 2/16 (13%)
Ig strand F 444..449 CDD:409353 2/4 (50%)
Ig strand G 457..460 CDD:409353 0/2 (0%)
I-set 468..559 CDD:400151
Ig strand B 486..490 CDD:409570
Ig strand C 499..503 CDD:409570
Ig strand E 525..529 CDD:409570
Ig strand F 539..544 CDD:409570
Ig strand G 552..555 CDD:409570
PTK_CCK4 686..1026 CDD:133178
BsgNP_033898.1 Ig 23..138 CDD:472250 30/131 (23%)
Ig strand B 40..44 CDD:409534 1/3 (33%)
Ig strand C 53..57 CDD:409534 2/3 (67%)
Ig strand E 91..95 CDD:409534 1/3 (33%)
Ig strand F 105..110 CDD:409534 2/4 (50%)
Ig strand G 129..132 CDD:409534 1/2 (50%)
IG_like 233..322 CDD:214653 24/91 (26%)
Ig strand B 237..242 CDD:409436 2/4 (50%)
Ig strand C 251..259 CDD:409436 1/7 (14%)
Ig strand E 277..281 CDD:409436 0/3 (0%)
Ig strand F 302..307 CDD:409436 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..389
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.