DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and IL1RAPL1

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:NP_055086.1 Gene:IL1RAPL1 / 11141 HGNCID:5996 Length:696 Species:Homo sapiens


Alignment Length:509 Identity:102/509 - (20%)
Similarity:166/509 - (32%) Gaps:133/509 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 KRGGAAGLEALPAAPEDLRIVQGPIGQSIIKEGEPTALTCL---------YELPDELKNQRIQLR 292
            |||.|.|......   |::..|       :..|||..:.|.         |.|   .::..:.|.
Human    24 KRGSADGCTDWSI---DIKKYQ-------VLVGEPVRIKCALFYGYIRTNYSL---AQSAGLSLM 75

  Fly   293 WRKDGKLLRQVELGGSAPIPGH-----SFDSGKDALLREDARLVLHKQNGTLSFASIIASDAGQY 352
            |.|...             ||.     :||..:           :.|:..::.|...:..|:|.|
Human    76 WYKSSG-------------PGDFEEPIAFDGSR-----------MSKEEDSIWFRPTLLQDSGLY 116

  Fly   353 QCQLQLEAHAPI--------NSSPGILEVIEQLKFVPQPTSKNLELDAVVAKVHCK-----AQGT 404
            .|.::...:...        .:..|:....:...|.....||:.|       :.|:     ...|
Human   117 ACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKE-------ISCRDIEDFLLPT 174

  Fly   405 PTPQVQWVRDGENTTLPDHVEVDANGTLIFRNVNSEHRGNYTCLATNSQGQINATVAINVVV--- 466
            ..|::.|.::....|....: |....||:.|.|..:..|||||........:..|..:.|..   
Human   175 REPEILWYKECRTKTWRPSI-VFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLT 238

  Fly   467 --TPKFSVPPVGPI---ETSEQGTVVMHCQAI----GDPKPTIQWDKDLKY---LSENNTDRERF 519
              .||...|....:   ||....:..:.|:|.    ||..|.|.|.|..|:   |.||.......
Human   239 DKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEKFIEDLDENRVWESDI 303

  Fly   520 RFLENG--------TLEIRNVQVEDEGSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEESGGDGF 576
            |.|:..        :|.:.:|:..|.|:|.|.:.|..|.:...|.|..:..  .:..|.:||.|.
Human   304 RILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHKREL--MYTVELAGGLGA 366

  Fly   577 LVTRAVLITMTVALAYIVLVVGLMLWCRYRRQARKARLNDLSTKEAGGD-------------QPD 628
            :    :|:.:.:...|....:.:||:.|          |....:|..||             .||
Human   367 I----LLLLVCLVTIYKCYKIEIMLFYR----------NHFGAEELDGDNKDYDAYLSYTKVDPD 417

  Fly   629 VAGNGKGSEQE------PCLSKQHNGHS---KSRSKSSGDAQKSDDTACSQQSR 673
            ......|.|:.      |.:.::|.|:.   ..|..........|...|..||:
Human   418 QWNQETGEEERFALEILPDMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSK 471

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352
Ig 31..115 CDD:299845
IGc2 133..195 CDD:197706
Ig 268..373 CDD:299845 20/126 (16%)
Ig 395..460 CDD:143165 15/69 (22%)
I-set 468..559 CDD:254352 29/108 (27%)
IGc2 484..549 CDD:197706 21/79 (27%)
PTK_CCK4 686..1026 CDD:133178
STYKc 692..1020 CDD:214568
IL1RAPL1NP_055086.1 Ig1_IL1RAPL-1_like 32..135 CDD:143304 21/139 (15%)
Ig 148..239 CDD:386229 21/98 (21%)
IGc2 260..341 CDD:197706 21/80 (26%)
TIR 405..559 CDD:366714 12/67 (18%)
Interaction with NCS1. /evidence=ECO:0000269|PubMed:12783849 549..644
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..680
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.