DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment otk and hmcn2

DIOPT Version :9

Sequence 1:NP_523705.2 Gene:otk / 36283 FlyBaseID:FBgn0004839 Length:1033 Species:Drosophila melanogaster
Sequence 2:XP_031747766.1 Gene:hmcn2 / 100490941 XenbaseID:XB-GENE-6034990 Length:4625 Species:Xenopus tropicalis


Alignment Length:961 Identity:213/961 - (22%)
Similarity:336/961 - (34%) Gaps:298/961 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 VPQSQSVVENESVKFEC--ESTDSYSELHYDWLHNGH----RIAYDKRVHQIGSNLHIEAVRRTE 88
            :|...||.|.:.||.||  |.|.:...|   |..:|:    .:..:.||.|.|:.|.:.:| :..
 Frog  3213 MPSEHSVPEKQEVKLECKTEGTPAPQIL---WFKDGNPLDVTLVPNTRVFQDGNFLVLRSV-QAS 3273

  Fly    89 DVGNYVCIATNLASGAREASPPAKLSVIYLESASVQLLGSNRNELL---------LKCHVEGASG 144
            |.|.|.|:|.|      .|....::.|:.:....:...|||.:::|         |:||   |||
 Frog  3274 DSGRYTCVARN------NAGEDTRVYVLNILVPPIFESGSNASDVLSSVPGGQVTLECH---ASG 3329

  Fly   145 DLEPLEIEWYRNSEKLSTWKNVQLDQHRLIIR--QPGSEDDGLYRCTASNAAGRVMSKQGYVYQS 207
            .| ||::.|:::...|||.:.|::.....|:|  |....|.|.|.|.||:.||  .:::.:|.. 
 Frog  3330 SL-PLKLSWFKDGHPLSTSRYVRIASGGRILRFSQVQVSDAGTYTCVASSPAG--AAEKNFVLH- 3390

  Fly   208 SVKCLPRLPRRKNEKMME---------------------SWDK-------QTFLCRGKRGGAAGL 244
             ::.||.|.|.::.:.:.                     ||:|       |:.|.....|....|
 Frog  3391 -IESLPVLERSESTEEVTAIKGASVTFTCEAHGTPLPSLSWEKDGQPLNLQSNLLPNGLGTRLHL 3454

  Fly   245 EAL-----------------------------------PAAPEDLRIV-QGPIGQSIIKEGEPTA 273
            |::                                   ||.|.::.|: ..|:..:....|.||.
 Frog  3455 ESVRALDSGIYSCIAVNAAGRVSKHFHLTVLEPPRIEGPALPTEVSIIADSPLELACTATGVPTP 3519

  Fly   274 LTCLYELPDELKNQRIQLRWRKDGKLLRQVELGGSAPIPGHSFDSGKDALLREDARLVLHKQNGT 338
                            ::.|.|||:.|                 |..|.|.|          |||
 Frog  3520 ----------------EISWEKDGRPL-----------------SHPDLLTR----------NGT 3541

  Fly   339 -LSFASIIASDAGQYQCQLQLEAHAPINSSPGILEVIEQLKFVPQPTSKNLELDAVVAKVHCKAQ 402
             |....:.|.|||.|.|.....|.....::...::|...:....:|.|..:.:...:. :.||.:
 Frog  3542 VLRIERVKAEDAGIYVCVATSTAGRDSRATWVRMKVPPSVVGSTEPRSLAVSVGGQLV-LECKVE 3605

  Fly   403 GTPTPQVQWVRDGENTTLPDHVEVDANGTLI-FRNVNSEHRGNYTCLATNSQGQINATVAINVVV 466
            ..|.|.:||.|..........|:|.:.|..: ..::.....|.|||:|:|..|:.:....:.:.:
 Frog  3606 ADPPPTIQWYRGDIPLQTDGRVQVLSKGRYVQIHSLRPSDSGEYTCIASNPAGRTSLHFTVEIQL 3670

  Fly   467 TPKFSVPPVGPIETSEQGTVVMHCQAIGDPKPTIQWDKDLKYLSENNTDRERFRFLENGTLEIRN 531
            .|... |....:..|...|.|:.|:..|.|.|...|.||...||   .:..|..||.:|:|.|..
 Frog  3671 APMIQ-PGPSVVSVSVNQTAVLPCRMEGIPLPVASWRKDGSPLS---VEISRMEFLADGSLRIPQ 3731

  Fly   532 VQVEDEGSYGCTIGNSAGLKREDVQLVVKTTGDGFAPEESGGDGFLVTRAVLITMTVALAYIVLV 596
            ..::|.|.|.||:.||||:.|..|:|.|...| ||:..:..|.   .||.               
 Frog  3732 ALLQDSGYYLCTVTNSAGMARRGVELRVFVHG-GFSQWQEWGP---CTRT--------------- 3777

  Fly   597 VGLMLWCRYRRQARKARLNDLSTKEAGGDQP----------------DVAGNGKG-SEQEPCLSK 644
                  |....|.|....|  :...|.|.:|                .|.|...| |...||.|.
 Frog  3778 ------CGQGIQERTRLCN--NPPPANGGRPCIGPDVEVRACKLPLCPVDGGWTGWSRWAPCSST 3834

  Fly   645 QHNGHSKSRSKS--------SGDAQKSDDTACSQQSRASKKSAHIYEQLALPRSGLSELIQIGRG 701
            ...| |:.|::|        .|.|....||.                         :|:.|:...
 Frog  3835 CGEG-SRQRTRSCFSPPPQNGGKACPGKDTE-------------------------TEICQLPPC 3873

  Fly   702 EFGDVFVGKLKATLVTSPSDKDADTEKQHSN-SENGSGGSGSGSTTLSTLNEKRRSKTSMDDIEE 765
            :.|.   .:::|:::...:|:|.......:| :||..    :|.||:::            .||.
 Frog  3874 QVGP---SRVRASVIGIINDQDFGISALSANLTENPL----TGLTTITS------------SIEN 3919

  Fly   766 IKEEEQDQHNQSGLEQLVLVKALNKVKDEQACQEFRRQLDLLRAISHKGVVRLFGLCREKDPHYM 830
            |..       ..|.....||..:             ..|....|::|.|.|..|.|.:.......
 Frog  3920 IPP-------SVGHLMRTLVSVI-------------APLYWSAALAHDGTVNGFTLTKGVFRKET 3964

  Fly   831 VLEYTDWGDLKQFLLATAGKVNTATAGSSSPPPLTTSQVLAVAYQIARGMD 881
            .||:                              .|.::|.|.: ||||:|
 Frog  3965 QLEF------------------------------ATGELLRVTH-IARGLD 3984

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
otkNP_523705.2 I-set 26..115 CDD:254352 26/90 (29%)
Ig 31..115 CDD:299845 26/89 (29%)
IGc2 133..195 CDD:197706 24/72 (33%)
Ig 268..373 CDD:299845 23/105 (22%)
Ig 395..460 CDD:143165 17/65 (26%)
I-set 468..559 CDD:254352 32/90 (36%)
IGc2 484..549 CDD:197706 24/64 (38%)
PTK_CCK4 686..1026 CDD:133178 35/197 (18%)
STYKc 692..1020 CDD:214568 35/191 (18%)
hmcn2XP_031747766.1 vWFA 29..165 CDD:238119
IG_like 434..503 CDD:214653
Ig strand B 434..438 CDD:409353
Ig strand C 447..451 CDD:409353
Ig strand E 469..473 CDD:409353
Ig strand F 483..488 CDD:409353
Ig 514..592 CDD:416386
Ig strand A' 515..518 CDD:409353
Ig strand B 524..531 CDD:409353
Ig strand C 537..542 CDD:409353
Ig strand C' 544..546 CDD:409353
Ig strand D 551..555 CDD:409353
Ig strand E 558..563 CDD:409353
Ig strand F 571..579 CDD:409353
Ig strand G 582..592 CDD:409353
I-set 596..681 CDD:400151
Ig strand B 613..617 CDD:409353
Ig strand C 626..630 CDD:409353
Ig strand E 648..652 CDD:409353
Ig strand F 662..667 CDD:409353
Ig strand G 676..679 CDD:409353
Ig 695..770 CDD:416386
Ig strand B 703..707 CDD:409353
Ig strand C 716..720 CDD:409353
Ig strand E 736..740 CDD:409353
Ig strand F 750..755 CDD:409353
Ig strand G 763..766 CDD:409353
Ig strand A 774..778 CDD:409353
IG_like 780..864 CDD:214653
Ig strand A' 781..786 CDD:409353
Ig strand B 790..798 CDD:409353
Ig strand C 804..809 CDD:409353
Ig strand C' 812..815 CDD:409353
Ig strand D 822..825 CDD:409353
Ig strand F 843..851 CDD:409353
I-set 870..957 CDD:400151
Ig strand A' 878..881 CDD:409353
Ig strand B 887..895 CDD:409353
Ig strand C 901..906 CDD:409353
Ig strand C' 909..911 CDD:409353
Ig strand D 917..921 CDD:409353
Ig strand E 923..927 CDD:409353
Ig strand F 936..944 CDD:409353
Ig strand G 947..957 CDD:409353
I-set 961..1048 CDD:400151
Ig strand A' 969..973 CDD:409353
Ig strand B 977..984 CDD:409353
Ig strand C 991..996 CDD:409353
Ig strand C' 998..1001 CDD:409353
Ig strand D 1007..1011 CDD:409353
Ig strand E 1014..1020 CDD:409353
Ig strand F 1027..1035 CDD:409353
Ig strand G 1038..1048 CDD:409353
Ig 1065..1146 CDD:416386
Ig strand A' 1067..1070 CDD:409353
Ig strand B 1076..1083 CDD:409353
Ig strand C 1089..1094 CDD:409353
Ig strand C' 1096..1098 CDD:409353
Ig strand D 1105..1109 CDD:409353
Ig strand E 1112..1117 CDD:409353
Ig strand F 1125..1133 CDD:409353
Ig strand G 1136..1146 CDD:409353
Ig 1157..1237 CDD:416386
Ig strand B 1167..1174 CDD:409353
Ig strand C 1180..1185 CDD:409353
Ig strand C' 1187..1189 CDD:409353
Ig strand D 1196..1200 CDD:409353
Ig strand E 1203..1208 CDD:409353
Ig strand F 1216..1224 CDD:409353
Ig strand G 1227..1237 CDD:409353
Ig 1241..1329 CDD:416386
Ig strand A 1241..1244 CDD:409353
Ig strand A' 1250..1253 CDD:409353
Ig strand B 1259..1266 CDD:409353
Ig strand C 1272..1277 CDD:409353
Ig strand C' 1280..1282 CDD:409353
Ig strand D 1289..1293 CDD:409353
Ig strand E 1295..1299 CDD:409353
Ig strand F 1308..1316 CDD:409353
Ig strand G 1319..1329 CDD:409353
I-set 1342..1420 CDD:400151
Ig strand A' 1343..1346 CDD:409353
Ig strand B 1352..1359 CDD:409353
Ig strand C 1365..1370 CDD:409353
Ig strand C' 1373..1375 CDD:409353
Ig strand D 1381..1385 CDD:409353
Ig strand E 1387..1392 CDD:409353
Ig strand F 1401..1409 CDD:409353
Ig strand G 1412..1420 CDD:409353
I-set 1434..1516 CDD:400151
Ig strand A' 1436..1439 CDD:409353
Ig strand B 1445..1452 CDD:409353
Ig strand C 1458..1463 CDD:409353
Ig strand C' 1465..1467 CDD:409353
Ig strand D 1474..1478 CDD:409353
Ig strand E 1481..1487 CDD:409353
Ig strand F 1495..1503 CDD:409353
I-set 1538..1609 CDD:400151
Ig strand B 1539..1546 CDD:409353
Ig strand C 1552..1557 CDD:409353
Ig strand C' 1559..1561 CDD:409353
Ig strand D 1567..1571 CDD:409353
Ig strand E 1574..1580 CDD:409353
Ig strand F 1588..1596 CDD:409353
Ig strand G 1599..1609 CDD:409353
Ig 1621..1703 CDD:416386
Ig strand A' 1624..1628 CDD:409353
Ig strand B 1632..1639 CDD:409353
Ig strand C 1646..1651 CDD:409353
Ig strand C' 1653..1656 CDD:409353
Ig strand D 1661..1665 CDD:409353
Ig strand E 1668..1675 CDD:409353
Ig strand F 1682..1690 CDD:409353
I-set 1717..1796 CDD:400151
Ig strand C 1739..1743 CDD:409353
Ig strand E 1762..1766 CDD:409353
Ig strand F 1776..1781 CDD:409353
Ig 1796..1880 CDD:416386
Ig strand A' 1801..1804 CDD:409353
Ig strand B 1818..1825 CDD:409353
Ig strand C 1831..1836 CDD:409353
Ig strand C' 1838..1840 CDD:409353
Ig strand F 1859..1867 CDD:409353
Ig strand G 1870..1880 CDD:409353
I-set 1886..1964 CDD:400151
Ig strand A' 1892..1895 CDD:409353
Ig strand B 1901..1908 CDD:409353
Ig strand C 1914..1919 CDD:409353
Ig strand C' 1920..1922 CDD:409353
Ig strand D 1929..1933 CDD:409353
Ig strand E 1936..1942 CDD:409353
Ig strand F 1950..1958 CDD:409353
Ig 1984..2063 CDD:416386
Ig strand B 1992..1999 CDD:409353
Ig strand C 2005..2010 CDD:409353
Ig strand C' 2012..2014 CDD:409353
Ig strand D 2022..2025 CDD:409353
Ig strand E 2029..2035 CDD:409353
Ig strand F 2042..2049 CDD:409353
Ig strand G 2055..2063 CDD:409353
Ig_3 2066..2141 CDD:404760
Ig strand B 2084..2088 CDD:409353
Ig strand C 2097..2101 CDD:409353
Ig strand E 2120..2124 CDD:409353
Ig strand F 2134..2139 CDD:409353
Ig strand A 2158..2161 CDD:409353
Ig strand A' 2167..2170 CDD:409353
Ig 2170..2246 CDD:416386
Ig strand B 2176..2183 CDD:409353
Ig strand C 2189..2194 CDD:409353
Ig strand C' 2197..2199 CDD:409353
Ig strand E 2204..2216 CDD:409353
Ig strand F 2225..2233 CDD:409353
Ig strand G 2236..2246 CDD:409353
I-set 2259..2340 CDD:400151
Ig strand B 2270..2274 CDD:409353
Ig strand C 2283..2287 CDD:409353
Ig strand E 2306..2310 CDD:409353
Ig strand F 2320..2325 CDD:409353
Ig_3 2343..2421 CDD:404760
Ig strand B 2364..2368 CDD:409353
Ig strand C 2377..2381 CDD:409353
Ig strand E 2400..2404 CDD:409353
Ig strand F 2414..2419 CDD:409353
Ig strand A 2437..2440 CDD:409353
I-set 2447..2526 CDD:400151
Ig strand A' 2447..2450 CDD:409353
Ig strand B 2455..2463 CDD:409353
Ig strand C 2469..2473 CDD:409353
Ig strand C' 2476..2479 CDD:409353
Ig strand D 2484..2488 CDD:409353
Ig strand E 2492..2497 CDD:409353
Ig strand F 2505..2513 CDD:409353
Ig strand G 2516..2526 CDD:409353
I-set 2530..2622 CDD:400151
Ig strand B 2552..2556 CDD:409353
Ig strand C 2565..2569 CDD:409353
Ig strand E 2588..2592 CDD:409353
Ig strand F 2602..2607 CDD:409353
I-set 2633..2720 CDD:400151
Ig strand B 2650..2654 CDD:409353
Ig strand C 2663..2667 CDD:409353
Ig strand E 2686..2690 CDD:409353
Ig strand F 2700..2705 CDD:409353
Ig 2760..2830 CDD:416386
Ig strand B 2760..2764 CDD:409353
Ig strand C 2773..2777 CDD:409353
Ig strand E 2797..2800 CDD:409353
Ig strand F 2810..2815 CDD:409353
I-set 2839..2925 CDD:400151
Ig strand A' 2845..2850 CDD:409353
Ig strand B 2855..2863 CDD:409353
Ig strand C 2867..2873 CDD:409353
Ig strand C' 2875..2877 CDD:409353
Ig strand D 2883..2889 CDD:409353
Ig strand E 2890..2896 CDD:409353
Ig strand F 2905..2912 CDD:409353
Ig strand G 2915..2923 CDD:409353
I-set 2929..3017 CDD:400151
Ig strand A 2929..2932 CDD:409353
Ig strand A' 2936..2941 CDD:409353
Ig strand B 2947..2954 CDD:409353
Ig strand C 2960..2965 CDD:409353
Ig strand D 2976..2979 CDD:409353
Ig strand E 2983..2989 CDD:409353
Ig strand F 2996..3003 CDD:409353
Ig strand G 3009..3017 CDD:409353
Ig strand A 3020..3029 CDD:409353
I-set 3034..3111 CDD:400151
Ig strand B 3039..3049 CDD:409353
Ig strand C 3053..3059 CDD:409353
Ig strand C' 3061..3064 CDD:409353
Ig strand E 3077..3083 CDD:409353
Ig strand F 3089..3098 CDD:409353
Ig_3 3116..3189 CDD:404760
Ig strand A 3119..3122 CDD:409353
Ig strand A' 3124..3128 CDD:409353
Ig strand B 3132..3139 CDD:409353
Ig strand C 3146..3151 CDD:409353
Ig strand C' 3153..3156 CDD:409353
Ig strand D 3162..3166 CDD:409353
Ig strand E 3168..3174 CDD:409353
Ig strand F 3181..3189 CDD:409353
Ig_3 3206..3284 CDD:404760 24/74 (32%)
Ig strand B 3225..3229 CDD:409353 2/3 (67%)
Ig strand C 3238..3242 CDD:409353 1/6 (17%)
Ig strand E 3263..3267 CDD:409353 1/3 (33%)
Ig strand F 3277..3282 CDD:409353 2/4 (50%)
Ig strand G 3291..3294 CDD:409353 0/2 (0%)
I-set 3318..3391 CDD:400151 26/80 (33%)
Ig strand B 3321..3325 CDD:409353 1/3 (33%)
Ig strand C 3334..3338 CDD:409353 0/3 (0%)
Ig strand E 3357..3361 CDD:409353 1/3 (33%)
Ig strand F 3371..3376 CDD:409353 2/4 (50%)
Ig strand A 3395..3398 CDD:409353 1/2 (50%)
Ig strand A' 3403..3408 CDD:409353 0/4 (0%)
I-set 3406..3484 CDD:400151 8/77 (10%)
Ig strand B 3414..3421 CDD:409353 0/6 (0%)
Ig strand C 3427..3432 CDD:409353 2/4 (50%)
Ig strand D 3443..3446 CDD:409353 1/2 (50%)
Ig strand E 3450..3456 CDD:409353 1/5 (20%)
Ig strand F 3463..3470 CDD:409353 0/6 (0%)
Ig strand G 3476..3484 CDD:409353 0/7 (0%)
Ig_3 3487..3561 CDD:404760 27/116 (23%)
Ig strand A' 3498..3501 CDD:409353 0/2 (0%)
Ig strand B 3507..3514 CDD:409353 0/6 (0%)
Ig strand C 3520..3525 CDD:409353 1/4 (25%)
Ig strand C' 3527..3529 CDD:409353 1/1 (100%)
Ig strand D 3534..3538 CDD:409353 2/3 (67%)
Ig strand E 3541..3546 CDD:409353 2/4 (50%)
Ig strand F 3554..3562 CDD:409353 3/7 (43%)
I-set 3585..3668 CDD:400151 19/83 (23%)
Ig strand A' 3589..3592 CDD:409353 1/2 (50%)
Ig strand B 3598..3605 CDD:409353 2/7 (29%)
Ig strand C 3611..3616 CDD:409353 2/4 (50%)
Ig strand C' 3618..3620 CDD:409353 0/1 (0%)
Ig strand D 3626..3630 CDD:409353 1/3 (33%)
Ig strand E 3633..3639 CDD:409353 1/5 (20%)
Ig strand F 3647..3655 CDD:409353 5/7 (71%)
Ig strand G 3658..3668 CDD:409353 1/9 (11%)
I-set 3672..3759 CDD:400151 32/90 (36%)
Ig strand A 3673..3676 CDD:409353 0/3 (0%)
Ig strand A' 3680..3683 CDD:409353 0/2 (0%)
Ig strand B 3689..3696 CDD:409353 2/6 (33%)
Ig strand C 3702..3707 CDD:409353 1/4 (25%)
Ig strand C' 3709..3711 CDD:409353 0/1 (0%)
Ig strand D 3718..3722 CDD:409353 1/3 (33%)
Ig strand E 3725..3730 CDD:409353 2/4 (50%)
Ig strand F 3738..3746 CDD:409353 4/7 (57%)
TSP1 3766..3817 CDD:214559 10/76 (13%)
TSP1 3822..3873 CDD:214559 15/76 (20%)
nidG2 3876..4057 CDD:412205 33/179 (18%)
EGF_CA 4111..4149 CDD:214542
EGF_CA 4151..4194 CDD:311536
EGF_CA 4196..4233 CDD:214542
EGF_CA 4234..4267 CDD:214542
EGF_CA 4276..4317 CDD:311536
EGF_CA 4319..4358 CDD:311536
EGF_CA 4424..4463 CDD:214542
EGF_CA 4464..4504 CDD:214542
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.