DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Hmg20b and Dsp1

DIOPT Version :9

Sequence 1:XP_006241006.1 Gene:Hmg20b / 362825 RGDID:1309235 Length:344 Species:Rattus norvegicus
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:190 Identity:48/190 - (25%)
Similarity:80/190 - (42%) Gaps:38/190 - (20%)


- Green bases have known domain annotations that are detailed below.


  Rat    30 VKQERSEGPRAGEKGPQEEEARPRPHAPDPAHSSQSPSQGHSPLLQPVKKRGWPK------GKKR 88
            |.:|:.......||..|..||..:.:.|                         ||      ||||
  Fly   227 VDKEKKRFHEMAEKDKQRYEAEMQNYVP-------------------------PKGAVVGRGKKR 266

  Rat    89 KKIL-PNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYLDEAEKE 152
            |:|. ||.||..::.:..|.|:.|.:::..:|:....:|.|.||.:||.:.|..||:|...||::
  Fly   267 KQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERD 331

  Rat   153 KQQYLKELWAYQQSEAYKVCTEKIQENKIKKEDSSSGLMNTLLNGHKGV------DCGDG 206
            |.:|.:|:..|:.|....:....:|.:...:...::.|.......|:.:      |.|||
  Fly   332 KARYEREMTEYKTSGKIAMSAPSMQASMQAQAQKAALLAAAAQQQHQQLEEQHDDDDGDG 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Hmg20bXP_006241006.1 NHP6B 26..229 CDD:227935 48/190 (25%)
HMGB-UBF_HMG-box 96..160 CDD:238686 20/63 (32%)
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061 7/24 (29%)
HMGB-UBF_HMG-box 275..339 CDD:238686 20/63 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.