DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and RPT6

DIOPT Version :9

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_011467.1 Gene:RPT6 / 852834 SGDID:S000003016 Length:405 Species:Saccharomyces cerevisiae


Alignment Length:207 Identity:46/207 - (22%)
Similarity:76/207 - (36%) Gaps:66/207 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KNTQECIETAYKNLVILEINPRDIIAIGIVNQRGTSVLWNLETGQPLHNAIGWSDCRSTPILKTL 126
            |..:|.||...|:..:.|       ::||...:|..:.....||                  |||
Yeast   158 KEIKEVIELPVKHPELFE-------SLGIAQPKGVILYGPPGTG------------------KTL 197

  Fly   127 L-HNVRHNVD--YVRYRSGLPLSSCF---SALKIRWLM----DHVPAV----------ATAIEEN 171
            | ..|.|:.|  ::|. ||..|...:   .:..:|.|.    :|.|::          :|.:|.:
Yeast   198 LARAVAHHTDCKFIRV-SGAELVQKYIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSTRVEGS 261

  Fly   172 KCLFGTLDSWL------LWNLTGGVEMGVHSTDITNAHYTSLMNVSTEQWDPKLCQFFRLPLNI- 229
                |..||.:      |.|...|.|.   |.:|.....|:.:::    .||.|.:..|:...| 
Yeast   262 ----GGGDSEVQRTMLELLNQLDGFET---SKNIKIIMATNRLDI----LDPALLRPGRIDRKIE 315

  Fly   230 --LPRIRSNSEI 239
              .|.:.:.:||
Yeast   316 FPPPSVAARAEI 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 FGGY_GK 12..534 CDD:198347 46/207 (22%)
glycerol_kin 21..543 CDD:273549 46/207 (22%)
RPT6NP_011467.1 RPT1 12..403 CDD:224143 46/207 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.