DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and RPT2

DIOPT Version :9

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_010277.1 Gene:RPT2 / 851557 SGDID:S000002165 Length:437 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:42/210 - (20%)
Similarity:71/210 - (33%) Gaps:84/210 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 IAAMMGEQPASLLGQLCVKAGQN---VCTLDDSCFVLLNTGREKLDSANGLITGIAHKLGEK--- 311
            |...:|:.| .|..|:...||:|   :..:|:...:    |.::.||.:|         ||:   
Yeast   253 IQKYLGDGP-RLCRQIFKVAGENAPSIVFIDEIDAI----GTKRYDSNSG---------GEREIQ 303

  Fly   312 ----------------------AATN--YTLEGAISNAG----------STVTWLRDKLQINT-E 341
                                  .|||  .||:.|:...|          ..::..:..|.|:| :
Yeast   304 RTMLELLNQLDGFDDRGDVKVIMATNKIETLDPALIRPGRIDRKILFENPDLSTKKKILGIHTSK 368

  Fly   342 INSNDNVVESLNTFIGENSMISSSCSSSMLNAECGLAAKRSEITFVPAFHGMYAPYWRHDARGII 406
            :|.:::|  :|.|.:.....:|.:...:|. .|.||.|.|..                       
Yeast   369 MNLSEDV--NLETLVTTKDDLSGADIQAMC-TEAGLLALRER----------------------- 407

  Fly   407 LGLTSQTTAENITQA 421
               ..|.|||:..||
Yeast   408 ---RMQVTAEDFKQA 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 FGGY_GK 12..534 CDD:198347 42/210 (20%)
glycerol_kin 21..543 CDD:273549 42/210 (20%)
RPT2NP_010277.1 PTZ00361 1..437 CDD:185575 42/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.