DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and RPT1A

DIOPT Version :10

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_175778.1 Gene:RPT1A / 841812 AraportID:AT1G53750 Length:426 Species:Arabidopsis thaliana


Alignment Length:102 Identity:26/102 - (25%)
Similarity:44/102 - (43%) Gaps:24/102 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 DPKLCQFFRLPLNI---LPRIRSNSEIFGYVLEGPLHGTPIAAMMGEQPA--SLLGQLCVKAG-- 273
            ||.|.:..||...:   ||.:.|.::||      .:|   ...|..|:..  .||.:||..:.  
plant   321 DPALLRPGRLDRKVEFGLPDLESRTQIF------KIH---TRTMNCERDIRFELLARLCPNSTGA 376

  Fly   274 --QNVCTLDDSCFVL-----LNTGREKLDSANGLITG 303
              ::||| :...:.:     ..|.::.||:.|.:|.|
plant   377 DIRSVCT-EAGMYAIRARRKTVTEKDFLDAVNKVIKG 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 ASKHA_ATPase-like 19..540 CDD:483947 26/102 (25%)
RPT1ANP_175778.1 PRK03992 113..423 CDD:179699 26/102 (25%)

Return to query results.
Submit another query.