DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and AT5G20000

DIOPT Version :10

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_197500.1 Gene:AT5G20000 / 832122 AraportID:AT5G20000 Length:419 Species:Arabidopsis thaliana


Alignment Length:112 Identity:24/112 - (21%)
Similarity:39/112 - (34%) Gaps:38/112 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 VKAGQNVCTLDDSCFVLLNTGREKLDSANGLITGIAHKLG-------------------EKAATN 315
            |:|...|..::::|.|                .|.|.|.|                   ||:...
plant     6 VEARPPVTAMEETCNV----------------KGAAAKQGEGLNKYYLQHLDELQRLQREKSYNL 54

  Fly   316 YTLEGAISNAGSTVTWLRDKLQINTEINSNDNVVESLNTFIGENSMI 362
            ..||...:...|.|..||::||:..|..|   .|..:...:|:|.::
plant    55 NRLEAQRNELNSRVRMLREELQLLQEPGS---YVGEVVKVMGKNKVL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 ASKHA_ATPase-like 19..540 CDD:483947 24/112 (21%)
AT5G20000NP_197500.1 PRK03992 36..413 CDD:179699 15/66 (23%)

Return to query results.
Submit another query.