DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and Kat60

DIOPT Version :10

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001262276.1 Gene:Kat60 / 53566 FlyBaseID:FBgn0040208 Length:605 Species:Drosophila melanogaster


Alignment Length:62 Identity:16/62 - (25%)
Similarity:28/62 - (45%) Gaps:8/62 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 GQNVC-----TLDDSCF--VLLNTGREKLDSANGLITGIAHKLGEKAATNYTLEGAISNAGS 327
            |.|:|     |:..:|.  .||..|::|..:..|: |.:|....|:...|..|...::..|:
  Fly    18 GTNLCLSFLATMTTTCSDRQLLRGGKQKTTTCVGM-TVMAKTTFEEICENAKLARDMALTGN 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 ASKHA_ATPase-like 19..540 CDD:483947 16/62 (26%)
Kat60NP_001262276.1 Kp60-NTD 62..129 CDD:439297 3/17 (18%)
PHA03291 <167..>253 CDD:223033
SpoVK 219..566 CDD:440232
RecA-like_KTNA1 327..493 CDD:410930
Vps4_C <570..603 CDD:462762
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.