DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and psmc5

DIOPT Version :9

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001003740.1 Gene:psmc5 / 445285 ZFINID:ZDB-GENE-030131-6547 Length:406 Species:Danio rerio


Alignment Length:113 Identity:29/113 - (25%)
Similarity:42/113 - (37%) Gaps:36/113 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KNTQECIETAYKNLVILEINPRDIIAIGIVNQRGTSVLWNLETGQPLHNAIGWSDCRSTPILKTL 126
            |..:|.||...|:..:.|       |:||...:|..:.....||                  |||
Zfish   159 KEIKEVIELPVKHPELFE-------ALGIAQPKGVLLYGPPGTG------------------KTL 198

  Fly   127 L-HNVRHNVD--YVRYRSGLPLSSCF---SALKIRWLM----DHVPAV 164
            | ..|.|:.|  ::|. ||..|...|   .|..:|.|.    :|.|::
Zfish   199 LARAVAHHTDCTFIRV-SGSELVQKFIGEGARMVRELFVMAREHAPSI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 FGGY_GK 12..534 CDD:198347 29/113 (26%)
glycerol_kin 21..543 CDD:273549 29/113 (26%)
psmc5NP_001003740.1 RPT1 4..404 CDD:224143 29/113 (26%)
AAA_16 153..>206 CDD:289934 17/71 (24%)
AAA 186..318 CDD:278434 19/79 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.