DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and kat-60L1

DIOPT Version :10

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001163523.1 Gene:kat-60L1 / 40715 FlyBaseID:FBgn0037375 Length:673 Species:Drosophila melanogaster


Alignment Length:208 Identity:39/208 - (18%)
Similarity:63/208 - (30%) Gaps:82/208 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 NLTGGVEMG--------------VHSTDIT---NAHYTSLMNVSTEQ----W-------DPKLCQ 221
            |..||:.:|              |.:.::.   .|..|:.|...::|    |       ||:|  
  Fly   172 NAPGGLGIGGSVPLRSKQRLPTQVSAAEVAPQPRASQTAQMPFPSQQQDNRWVSSLRRRDPEL-- 234

  Fly   222 FFRLPLNILPRIRSNSEIFGYVLEGPLHGTP----IAAMMGEQPASLLGQLCVKAGQNVCTLDDS 282
                 ...||.|.||:.  ...|....||:.    :|......||:.:|.:              
  Fly   235 -----QPTLPSINSNAN--SSSLSQSHHGSAGNVGLAGAGAPTPAASMGTM-------------- 278

  Fly   283 CFVLLNTGREKLDSANGLITGIAHKLGEKAATNYTLEGAISNAGSTVTWLRDKLQINTEINSNDN 347
                                    :||..|..: .:..|:..:.|.......||..||::|....
  Fly   279 ------------------------RLGRPARAS-AMTAALRKSRSVERLRARKLSTNTQLNLKHK 318

  Fly   348 VVESLNTFIGENS 360
            .|:  ...:.|||
  Fly   319 PVK--KNSLDENS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 ASKHA_ATPase-like 19..540 CDD:483947 39/208 (19%)
kat-60L1NP_001163523.1 P-loop containing Nucleoside Triphosphate Hydrolases 395..561 CDD:476819
AAA_lid_3 591..629 CDD:465537
Vps4_C <638..671 CDD:462762
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.