DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and psmc1a

DIOPT Version :10

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_956327.1 Gene:psmc1a / 336786 ZFINID:ZDB-GENE-030131-8730 Length:440 Species:Danio rerio


Alignment Length:79 Identity:15/79 - (18%)
Similarity:26/79 - (32%) Gaps:37/79 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RHNVDYVRYRSGLPLSSCFSALKIRWLMDHVPAVATAIEENKCLFGTLDSWLLWNLTGGVEMGVH 195
            |..||.:|   |.|:|              |..:...|::|..:.                    
Zfish    96 RSKVDDLR---GTPMS--------------VGTLEEIIDDNHAIV-------------------- 123

  Fly   196 STDITNAHYTSLMN 209
            ||.:.:.||.|:::
Zfish   124 STSVGSEHYVSILS 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 ASKHA_ATPase-like 19..540 CDD:483947 15/79 (19%)
psmc1aNP_956327.1 PTZ00361 25..440 CDD:185575 15/79 (19%)

Return to query results.
Submit another query.