DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and Rpt6

DIOPT Version :9

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_608447.1 Gene:Rpt6 / 33105 FlyBaseID:FBgn0020369 Length:405 Species:Drosophila melanogaster


Alignment Length:113 Identity:27/113 - (23%)
Similarity:41/113 - (36%) Gaps:36/113 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KNTQECIETAYKNLVILEINPRDIIAIGIVNQRGTSVLWNLETGQPLHNAIGWSDCRSTPILKTL 126
            |..:|.||...|       :|....|:||...:|..:.....||                  |||
  Fly   158 KEIKEVIELPVK-------HPELFDALGIAQPKGVLLYGPPGTG------------------KTL 197

  Fly   127 L-HNVRHNVD--YVRYRSGLPLSSCF---SALKIRWLM----DHVPAV 164
            | ..|.|:.:  ::|. ||..|...|   .:..:|.|.    :|.|::
  Fly   198 LARAVAHHTECTFIRV-SGSELVQKFIGEGSRMVRELFVMAREHAPSI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 FGGY_GK 12..534 CDD:198347 27/113 (24%)
glycerol_kin 21..543 CDD:273549 27/113 (24%)
Rpt6NP_608447.1 RPT1 17..403 CDD:224143 27/113 (24%)
SlyX <27..>69 CDD:294687
AAA_16 152..>205 CDD:289934 17/71 (24%)
AAA 185..317 CDD:278434 17/79 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.