DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and Katna1

DIOPT Version :10

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_035965.3 Gene:Katna1 / 23924 MGIID:1344353 Length:491 Species:Mus musculus


Alignment Length:31 Identity:10/31 - (32%)
Similarity:16/31 - (51%) Gaps:5/31 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 TWLRDKLQ-----INTEINSNDNVVESLNTF 355
            |.||.|.|     ||.|.....:::::|.:|
Mouse    46 THLRQKWQQVWQEINVEAKQVKDIMKTLESF 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 ASKHA_ATPase-like 19..540 CDD:483947 10/31 (32%)
Katna1NP_035965.3 Interaction with microtubules, sufficient for microtubule severing activity. /evidence=ECO:0000269|PubMed:28436967 1..185 10/31 (32%)
Interaction with dynein and NDEL1. /evidence=ECO:0000250 1..75 9/28 (32%)
Interaction with KATNB1 1..29
Kp60-NTD 4..72 CDD:439297 8/25 (32%)
SpoVK 61..469 CDD:440232 3/16 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..182
RecA-like_KTNA1 210..379 CDD:410930
Vps4_C <456..489 CDD:462762
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.