DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and Katna1

DIOPT Version :9

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_035965.2 Gene:Katna1 / 23924 MGIID:1344353 Length:493 Species:Mus musculus


Alignment Length:31 Identity:10/31 - (32%)
Similarity:16/31 - (51%) Gaps:5/31 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 TWLRDKLQ-----INTEINSNDNVVESLNTF 355
            |.||.|.|     ||.|.....:::::|.:|
Mouse    48 THLRQKWQQVWQEINVEAKQVKDIMKTLESF 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 FGGY_GK 12..534 CDD:198347 10/31 (32%)
glycerol_kin 21..543 CDD:273549 10/31 (32%)
Katna1NP_035965.2 AAA 243..384 CDD:214640
AAA 247..383 CDD:278434
Vps4_C <458..491 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.