DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and rpt-6

DIOPT Version :9

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_499609.1 Gene:rpt-6 / 176661 WormBaseID:WBGene00004506 Length:416 Species:Caenorhabditis elegans


Alignment Length:283 Identity:57/283 - (20%)
Similarity:95/283 - (33%) Gaps:94/283 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 KNTQECIETAYKNLVILEINPRDIIAIGIVNQRGTSVLWNLETGQPLHNAIGWSDCRSTPILKTL 126
            |..:|.||...|       :|....|:||...:|..:.....||                  |||
 Worm   169 KEIKEVIELPVK-------HPELFDALGIAQPKGVLLFGPPGTG------------------KTL 208

  Fly   127 L-HNVRHNVD--YVRYRSGLPLSSCF---SALKIRWL-------------MDHVPAVATAIEENK 172
            | ..|.|:.:  ::|. ||..|...|   .|..:|.|             ||.:.::.::..|..
 Worm   209 LARAVAHHTECTFIRV-SGSELVQKFIGEGARMVRELFVMAREHAPSIIFMDEIDSIGSSRVEGS 272

  Fly   173 C------------LFGTLDSWLLWNLTGGVE--MGVHSTDITNAHYTSLMNVSTEQWDPKLCQFF 223
            .            |...||.   :..|..::  |..:..||.               ||.|.:..
 Worm   273 SGGDSEVQRTMLELLNQLDG---FEATKNIKVIMATNRIDIL---------------DPALLRPG 319

  Fly   224 RLPLNI---LPRIRSNSEIFGYVLEGPLHGTPIAAMMGEQPASLLGQLCVKAG---QNVCTLDDS 282
            |:...|   .|..::.::|.      .:|...:..|.|...|.:..|:...:|   ::||| :..
 Worm   320 RIDRKIEFPAPDEKARADIL------KIHSRKMNLMRGINMAKIAEQIPGASGAEVKSVCT-EAG 377

  Fly   283 CFVL----LNTGREKLDSANGLI 301
            .|.|    ::..:|..:.|.|.:
 Worm   378 MFALRERRIHVTQEDFEMAVGKV 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 FGGY_GK 12..534 CDD:198347 57/283 (20%)
glycerol_kin 21..543 CDD:273549 57/283 (20%)
rpt-6NP_499609.1 RPT1 10..414 CDD:224143 57/283 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.