DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and Gk

DIOPT Version :10

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_006527892.1 Gene:Gk / 14933 MGIID:106594 Length:587 Species:Mus musculus


Alignment Length:90 Identity:22/90 - (24%)
Similarity:38/90 - (42%) Gaps:18/90 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 KIEEAPRRIRDVI--NVF------HHIKQVRSQNFVG-KTQSYSKL----YLLLKATLSAQSFRV 184
            |||.:...:.:||  :||      |.|:..::.|.:. ..:::..|    |||:..|.......|
Mouse    74 KIEISQNDVLEVIEADVFSNLPKLHEIRIEKANNLLYINPEAFQNLPSLRYLLISNTGIKHLPAV 138

  Fly   185 QKKQTKQNKKIQIK-----HTKTKN 204
            .|.|:.|...:.|:     |...:|
Mouse   139 HKIQSLQKVLLDIQDNINIHIVARN 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 ASKHA_ATPase-like 19..540 CDD:483947 22/90 (24%)
GkXP_006527892.1 ASKHA_NBD_FGGY_GK1-3-like 11..544 CDD:466802 22/90 (24%)

Return to query results.
Submit another query.