DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and LOC1273891

DIOPT Version :10

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:XP_312924.4 Gene:LOC1273891 / 1273891 -ID:- Length:438 Species:Anopheles gambiae


Alignment Length:88 Identity:18/88 - (20%)
Similarity:31/88 - (35%) Gaps:38/88 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 RHNVDYVRYRSGLPLSSCFSALKIRWLMDHVPAVATAIEENKCLFGTLDSWLLWNLTGGVEMGVH 195
            |..||.:|   |.|:|              |..:...|::|..:.                    
Mosquito    94 RSKVDDLR---GSPMS--------------VGTLEEIIDDNHAIV-------------------- 121

  Fly   196 STDITNAHYTSLMN-VSTEQWDP 217
            ||.:.:.||.|::: |..:|.:|
Mosquito   122 STSVGSEHYVSILSFVDKDQLEP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 ASKHA_ATPase-like 19..540 CDD:483947 18/88 (20%)
LOC1273891XP_312924.4 PTZ00361 1..438 CDD:185575 18/88 (20%)

Return to query results.
Submit another query.