DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and KATNA1

DIOPT Version :9

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_008975.1 Gene:KATNA1 / 11104 HGNCID:6216 Length:491 Species:Homo sapiens


Alignment Length:267 Identity:45/267 - (16%)
Similarity:89/267 - (33%) Gaps:99/267 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 TWLRDKLQ-----INTEINSNDNVVESLNTFIGENSMISSSCSSSMLNAECGLAAKRSEITFVPA 389
            |:|:.|.|     ||.|.....:::::|.:|..:::.:.:        |:..|.|...|:..:|.
Human    46 TYLQQKWQQVWQEINVEAKHVKDIMKTLESFKLDSTPLKA--------AQHDLPASEGEVWSMPV 102

  Fly   390 -------------FHGMYAPYWRHDARGIILGLTSQTTAENI----------------------- 418
                         ....|:....|..|........:::|:|:                       
Human   103 PVERRPSPGPRKRQSSQYSDPKSHGNRPSTTVRVHRSSAQNVHNDRGKAVRCREKKEQNKGREEK 167

  Fly   419 --TQAA--------YEATGFQIFEVLQAFKRD----TPN--WDRSSMQPVLTFGGDYAENLHLVQ 467
              :.||        :::||:. .::::|.:||    .||  ||            |.|:.:...:
Human   168 NKSPAAVTEPETNKFDSTGYD-KDLVEALERDIISQNPNVRWD------------DIADLVEAKK 219

  Fly   468 FIADIIGYMLERPQ-------------TTSPAGLGVMITAGVTMKVVSLEHAVKMYTPPTDVFSP 519
            .:.:.:...:..|:             ...|.|.|..:.|    |.|:.|.....:    :|.|.
Human   220 LLKEAVVLPMWMPEFFKGIRRPWKGVLMVGPPGTGKTLLA----KAVATECKTTFF----NVSSS 276

  Fly   520 TTTKNRR 526
            |.|...|
Human   277 TLTSKYR 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 FGGY_GK 12..534 CDD:198347 45/267 (17%)
glycerol_kin 21..543 CDD:273549 45/267 (17%)
KATNA1NP_008975.1 Interaction with microtubules 1..185 21/146 (14%)
Interaction with dynein and NDEL1. /evidence=ECO:0000250 1..75 8/28 (29%)
Interaction with KATNB1. /evidence=ECO:0000269|PubMed:10751153 1..29
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 87..185 11/97 (11%)
AAA 241..382 CDD:214640 12/51 (24%)
AAA 245..381 CDD:278434 12/47 (26%)
Vps4_C <456..489 CDD:286426
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.