DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8298 and atad2b

DIOPT Version :9

Sequence 1:NP_610718.1 Gene:CG8298 / 36282 FlyBaseID:FBgn0033673 Length:596 Species:Drosophila melanogaster
Sequence 2:NP_001352895.1 Gene:atad2b / 100331225 ZFINID:ZDB-GENE-110411-210 Length:1402 Species:Danio rerio


Alignment Length:230 Identity:42/230 - (18%)
Similarity:75/230 - (32%) Gaps:73/230 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 GEQPASLLGQLCVKAGQNVCTLDD-SCFVL-LNTGREKLDSANGLI-----------TGIAHKLG 309
            |.:.::::.|     |....|||: ||..: |:..::.| .|||.:           |......|
Zfish  1162 GAEDSTVMAQ-----GDACLTLDESSCDTMELHPEKQPL-QANGHVLSTEEENSCEPTAARDAQG 1220

  Fly   310 EKAAT-------------------NYTLEGAISNAGSTVTWLRDKLQINTEINSNDNVVESLNTF 355
            ::.|.                   |.:::...|.|....|..||.|:.....:...:..|...  
Zfish  1221 QEEAPSEEPTVAPTVPAPQECVNGNESMDSVYSEAPDKDTIKRDALEQKPTEHKEASGTECST-- 1283

  Fly   356 IGENSMISSSCSS--------SMLNAECGL----------AAKRSEITFVPAFHGMYAPYWRHDA 402
             |||:..:.:.:|        |....|||.          |.:..|...:|....:...:.|..|
Zfish  1284 -GENTRTAEAVASDGDHEKEGSSKGKECGKGLSEVQAEEPAVRLQEAVQLPPPPDLVVDHQRLKA 1347

  Fly   403 RGIILGLTSQTTAENITQAAYEATGFQIFEVLQAF 437
            .              :.||..::.||.:..:.:.|
Zfish  1348 L--------------LEQAVVKSEGFSVDHLERVF 1368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8298NP_610718.1 FGGY_GK 12..534 CDD:198347 42/230 (18%)
glycerol_kin 21..543 CDD:273549 42/230 (18%)
atad2bNP_001352895.1 SpoVK <341..657 CDD:223540
P-loop_NTPase 767..879 CDD:328724
Bromo_AAA 957..1068 CDD:99957
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0554
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.