DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and RBL6

DIOPT Version :10

Sequence 1:NP_523704.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_172735.1 Gene:RBL6 / 837831 AraportID:AT1G12750 Length:307 Species:Arabidopsis thaliana


Alignment Length:177 Identity:41/177 - (23%)
Similarity:72/177 - (40%) Gaps:48/177 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 WPMFLSTFSHYSAMHLFANMYVMHSFANAAAVSLGKEQFLAVYLSAGVFSSLMSVLYKAATSQAG 250
            |.:..:.:.|...:||..||:.:..|........|..:...:||.:|...|::|.|:    .|..
plant    98 WRLITAMWLHAGIIHLVMNMFDVIIFGIRLEQQFGFIRIGLIYLISGFGGSILSALF----LQKS 158

  Fly   251 MSLGASGAIMTLLAYVCTQ-------YPD---TQLSILFLPALTFSAGAGIKVLMGIDFAGVVMG 305
            :|:|||||::.|:..:.::       |..   ..||.||:.|:..:.|              ::.
plant   159 ISVGASGALLGLMGAMLSELLTNWTIYKSKLCALLSFLFIIAINLAIG--------------LLP 209

  Fly   306 WKFFDHAAHLGGAMFGIF------------W------ATYGAQIWAK 334
            |  .|:.||:||.:.|..            |      :.|||:..:|
plant   210 W--VDNFAHIGGLLTGFCLGFILLMQPQSGWEEFRNSSQYGARARSK 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_523704.1 Rhomboid 186..327 CDD:426384 37/168 (22%)
RBL6NP_172735.1 Rhomboid 91..234 CDD:426384 36/155 (23%)

Return to query results.
Submit another query.