Sequence 1: | NP_001286324.1 | Gene: | rho-7 / 36281 | FlyBaseID: | FBgn0033672 | Length: | 351 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005164392.1 | Gene: | rhbdf1a / 798402 | ZFINID: | ZDB-GENE-040704-75 | Length: | 893 | Species: | Danio rerio |
Alignment Length: | 228 | Identity: | 42/228 - (18%) |
---|---|---|---|
Similarity: | 76/228 - (33%) | Gaps: | 71/228 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 LCNLVAFAMWRVPALKSTMITYFTSNPAAKVVCWPMFLSTFSHYSAMHLFANMYVMHSFANAAAV 217
Fly 218 SLGKEQFLAVYLSAGVFSSLMSVL---YKAATSQAGMSLGASGAIMT-------LLAYVCTQYPD 272
Fly 273 TQLSILFLPALTFSAGAGIKVLMGIDFAGVVMGWKFFDHAAHLGGAMFGIF-------WATYG-A 329
Fly 330 QIWAKR----------IGL------LNYYHDLR 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho-7 | NP_001286324.1 | Rhomboid | 186..327 | CDD:396315 | 29/157 (18%) |
rhbdf1a | XP_005164392.1 | Rhomboid_SP | 130..347 | CDD:289371 | |
Rhomboid | 685..826 | CDD:279958 | 30/160 (19%) | ||
DUF805 | <792..864 | CDD:294752 | 19/91 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |