DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and rhbdf1a

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_005164392.1 Gene:rhbdf1a / 798402 ZFINID:ZDB-GENE-040704-75 Length:893 Species:Danio rerio


Alignment Length:228 Identity:42/228 - (18%)
Similarity:76/228 - (33%) Gaps:71/228 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LCNLVAFAMWRVPALKSTMITYFTSNPAAKVVCWPMFLSTFSHYSAMHLFANMYVMHSFANAAAV 217
            :|.|:.|.                 ||......:.::||.|.|...:|...::....:.......
Zfish   676 VCGLLPFL-----------------NPEVPDQFYRLWLSLFLHAGILHCLVSVCFQMTILRDLEK 723

  Fly   218 SLGKEQFLAVYLSAGVFSSLMSVL---YKAATSQAGMSLGASGAIMT-------LLAYVCTQYPD 272
            ..|..:...:|:.:|:..:|.|.:   |:|....||...|....:..       :||.....:..
Zfish   724 LAGWLRISIIYILSGITGNLASAIFLPYRAEVGPAGSQFGILACLFVELIQSWQILAQPWRAFTK 788

  Fly   273 TQLSILFLPALTFSAGAGIKVLMGIDFAGVVMGWKFFDHAAHLGGAMFGIF-------WATYG-A 329
            ....:|||                  ||..::.|  .|:.||:.|.:.|.|       :.::| .
Zfish   789 LLCVVLFL------------------FAFGLLPW--IDNFAHISGFISGFFLSFAFLPYISFGRL 833

  Fly   330 QIWAKR----------IGL------LNYYHDLR 346
            .::.||          :||      |.|.|.::
Zfish   834 DMYRKRCQIIIFLVVFLGLFAGLVVLFYVHPIK 866

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 29/157 (18%)
rhbdf1aXP_005164392.1 Rhomboid_SP 130..347 CDD:289371
Rhomboid 685..826 CDD:279958 30/160 (19%)
DUF805 <792..864 CDD:294752 19/91 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.