DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and RHBDF2

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_078875.4 Gene:RHBDF2 / 79651 HGNCID:20788 Length:856 Species:Homo sapiens


Alignment Length:215 Identity:34/215 - (15%)
Similarity:64/215 - (29%) Gaps:74/215 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LCNLVAFAMWRVPALKSTMITYFTSNPAAKVVCWPMFLSTFSHYSAMHLFANMYVMHSFANAAAV 217
            :|.|:.|.                 ||......:.::||.|.|...:|...::....:.......
Human   639 VCGLLPFL-----------------NPEVPDQFYRLWLSLFLHAGVVHCLVSVVFQMTILRDLEK 686

  Fly   218 SLGKEQFLAVYLSAGVFSSLMSVL---YKAATSQAGMSLGASGAI-------------------- 259
            ..|..:...:::.:|:..:|.|.:   |:|....||...|....:                    
Human   687 LAGWHRIAIIFILSGITGNLASAIFLPYRAEVGPAGSQFGLLACLFVELFQSWPLLERPWKAFLN 751

  Fly   260 ---MTLLAYVCTQYP-------------DTQLSILFLPALTFSAG----------AGIKVLMGID 298
               :.|..::|...|             ...|:..|||.:||...          ..:....|: 
Human   752 LSAIVLFLFICGLLPWIDNIAHIFGFLSGLLLAFAFLPYITFGTSDKYRKRALILVSLLAFAGL- 815

  Fly   299 FAGVVM-------GWKFFDH 311
            ||.:|:       .|.:.:|
Human   816 FAALVLWLYIYPINWPWIEH 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 29/182 (16%)
RHBDF2NP_078875.4 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..115
Rhomboid_SP 128..334 CDD:289371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 165..184
Involved in interaction with FRMD8. /evidence=ECO:0000269|PubMed:29897333 191..271
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 531..553
Rhomboid 648..789 CDD:279958 20/140 (14%)
GtrA 748..832 CDD:303012 14/84 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.