Sequence 1: | NP_001286324.1 | Gene: | rho-7 / 36281 | FlyBaseID: | FBgn0033672 | Length: | 351 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_078875.4 | Gene: | RHBDF2 / 79651 | HGNCID: | 20788 | Length: | 856 | Species: | Homo sapiens |
Alignment Length: | 215 | Identity: | 34/215 - (15%) |
---|---|---|---|
Similarity: | 64/215 - (29%) | Gaps: | 74/215 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 LCNLVAFAMWRVPALKSTMITYFTSNPAAKVVCWPMFLSTFSHYSAMHLFANMYVMHSFANAAAV 217
Fly 218 SLGKEQFLAVYLSAGVFSSLMSVL---YKAATSQAGMSLGASGAI-------------------- 259
Fly 260 ---MTLLAYVCTQYP-------------DTQLSILFLPALTFSAG----------AGIKVLMGID 298
Fly 299 FAGVVM-------GWKFFDH 311 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho-7 | NP_001286324.1 | Rhomboid | 186..327 | CDD:396315 | 29/182 (16%) |
RHBDF2 | NP_078875.4 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..115 | ||
Rhomboid_SP | 128..334 | CDD:289371 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 165..184 | ||||
Involved in interaction with FRMD8. /evidence=ECO:0000269|PubMed:29897333 | 191..271 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 531..553 | ||||
Rhomboid | 648..789 | CDD:279958 | 20/140 (14%) | ||
GtrA | 748..832 | CDD:303012 | 14/84 (17%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |