DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and ru

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_524790.1 Gene:ru / 44856 FlyBaseID:FBgn0003295 Length:341 Species:Drosophila melanogaster


Alignment Length:225 Identity:51/225 - (22%)
Similarity:80/225 - (35%) Gaps:49/225 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 RRHWDSLTPGDKMFAP--ILLCNL--VAFAMW-RVPALKSTMITYFTSNPAAKVVCWPMFLSTFS 194
            :.|..|..| .|...|  |:|..|  |...:| .....:.:::.|   .|..::..|........
  Fly    84 KHHEGSAAP-FKWIPPFFIILATLLEVLVFLWVGADPPEDSLLVY---RPDQRLQLWRFLSYALL 144

  Fly   195 HYSAMHLFANMYVMHSFANAAAVSLGKEQFLAVYLSAGVFSSLMSVLYKAATSQAGMSLGASGAI 259
            |.|.:||..|:.....|.....:..|..:...:|: |||   |...|..:........:||||.:
  Fly   145 HASWLHLGYNVLTQLLFGVPLELVHGSLRTGVIYM-AGV---LAGSLGTSVVDSEVFLVGASGGV 205

  Fly   260 MTLLAYVCTQYPDTQLSILFLPALTFSAGAGIKVLMGIDFAGVVMGWKFF--------------- 309
            ..|||        .||:.|.|.......|. |:::..|.|....:|:..:               
  Fly   206 YALLA--------AQLASLLLNFGQMRHGV-IQLMAVILFVFCDLGYALYSRELAMHQLQTRPSV 261

  Fly   310 DHAAHLGGAMFGIFWATYGAQIWAKRIGLL 339
            .:.||:.||:.||            .:|||
  Fly   262 SYIAHMTGALAGI------------SVGLL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 36/155 (23%)
ruNP_524790.1 Rhomboid 129..282 CDD:279958 40/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444958
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.