DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and Rhbdf2

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001100537.2 Gene:Rhbdf2 / 303690 RGDID:1309699 Length:825 Species:Rattus norvegicus


Alignment Length:205 Identity:34/205 - (16%)
Similarity:63/205 - (30%) Gaps:68/205 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LCNLVAFAMWRVPALKSTMITYFTSNPAAKVVCWPMFLSTFSHYSAMHLFANMYVMHSFANAAAV 217
            :|.|:.|.                 ||......:.::||.|.|...:|...::....:.......
  Rat   608 VCGLLPFL-----------------NPEIPDQFYRIWLSLFLHAGIVHCLVSVVFQMTILRDLEK 655

  Fly   218 SLGKEQFLAVYLSAGVFSSLMSVL---YKAATSQAGMSLGASGAI-------------------- 259
            ..|..:...:::.:|:..:|.|.:   |:|....||...|....:                    
  Rat   656 LAGWHRISIIFILSGITGNLASAIFLPYRAEVGPAGSQFGLLACLFVELFQSWQLLERPWKAFFN 720

  Fly   260 ---MTLLAYVCTQYP-------------DTQLSILFLPALTFSAG----------AGIKVLMGID 298
               :.|..::|...|             ...|:..|||.:||...          ..:.|..|: 
  Rat   721 LSAIVLFLFICGLLPWIDNIAHIFGFLSGMLLAFAFLPYITFGTSDRYRKQALILVSLLVFAGL- 784

  Fly   299 FAGVVMGWKF 308
            ||.:|: |.:
  Rat   785 FASLVL-WLY 793

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 29/172 (17%)
Rhbdf2NP_001100537.2 Rhomboid_SP 98..302 CDD:403706
Rhomboid 617..758 CDD:396315 20/140 (14%)
MFS 718..>808 CDD:421695 15/78 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.