DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and Rhbdl3

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_001099289.1 Gene:Rhbdl3 / 287556 RGDID:1311901 Length:404 Species:Rattus norvegicus


Alignment Length:284 Identity:63/284 - (22%)
Similarity:103/284 - (36%) Gaps:72/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NTRSLILEKARQARFGWWQSRSLADRDYWTQIKQDIRRHW--DSLT--PGDKMFAPILLCNLVAF 159
            ::::|:.||      |...|:.|.....:..:.::|.|.|  ||.|  |.......|.|..:..|
  Rat   119 SSKALLEEK------GLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITITLLEVALF 177

  Fly   160 AMWRVPALKSTMITYFTSNPAAKVVCWPMFL-STFSHYSAMHLFANMYVMHSFANAAAVSLGKEQ 223
                  .....::..|...     |..|.:| ::..::..:...|..||.:.|.:|....||.. 
  Rat   178 ------LYNGVLLDQFVLQ-----VTHPRYLKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLN- 230

  Fly   224 FLAVYLSAGV------FSSLMSVLYKA-------ATSQAGMS---LGASGAIMTL----LAYVCT 268
             :|:.|..||      .::.:.::|.|       |.|.|.|:   :|:||.:..|    ||.:..
  Rat   231 -VALQLLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVM 294

  Fly   269 QYPDTQLSILFLPALTFSAGAGIKVLMGIDFAGVVMGWKFF-----------DHAAHLGGAMFGI 322
            .:...:.....|..      |...:.|.::|...|  |..|           ...|||||...||
  Rat   295 NWSGMKCQFKLLRM------AVALICMSMEFGRAV--WLRFHPSAYPPCPHPSFVAHLGGVAVGI 351

  Fly   323 FWATYGAQIWAKRIGLLNYYHDLR 346
               |.|..:      |.||...|:
  Rat   352 ---TLGVVV------LRNYEQRLQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 39/172 (23%)
Rhbdl3NP_001099289.1 EF-hand_7 36..100 CDD:404394
Rhomboid 205..359 CDD:396315 39/172 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.