DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and Rhbdl3

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_006533389.1 Gene:Rhbdl3 / 246104 MGIID:2179276 Length:433 Species:Mus musculus


Alignment Length:251 Identity:56/251 - (22%)
Similarity:87/251 - (34%) Gaps:56/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NTRSLILEKARQARFGWWQSRSLADRDYWTQIKQDIRRHW--DSLT--PGDKMFAPILLCNLVAF 159
            ::::|:.||      |...|:.|.....:..:.::|.|.|  ||.|  |.......|.|..:..|
Mouse   119 SSKALLEEK------GLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPPWFMITITLLEVALF 177

  Fly   160 AMWRVPALKSTMITYFTSNPAAKVVCWPMFL-STFSHYSAMHLFANMYVMHSFANAAAVSLGKE- 222
                  .....::..|...     |..|.:| ::..::..:...|..||.:.|.:|....||.. 
Mouse   178 ------LYNGVLLDQFVLQ-----VTHPRYLKNSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNV 231

  Fly   223 --QFLA---------------VYLSAGVFSSLM--SVLYKAATSQAGMSLGASGAIMTLLAYVCT 268
              |.|.               ||: |||.:.|:  .|..:||....|:.|...|.....:|    
Mouse   232 ALQLLVGVPLEMVHGATRIGLVYV-AGVVAELVRHEVPVQAAADGCGLDLYEYGVRKGCMA---- 291

  Fly   269 QYPDTQLSILFLPALT---------FSAGAGIKVLMGIDFAGVVMGWKFFDHAAHL 315
            .:|...||.:..|.|.         ...|.|....:..:.||.|......||..||
Mouse   292 PFPPIGLSPVPPPKLCGTLGWRGRGHHPGRGGSQKLRAEAAGPVAVVDLCDHVHHL 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 38/160 (24%)
Rhbdl3XP_006533389.1 EF-hand_7 36..100 CDD:372618
Rhomboid 207..>260 CDD:389796 14/53 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.