DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and Rhbdl2

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_898986.2 Gene:Rhbdl2 / 230726 MGIID:3608413 Length:302 Species:Mus musculus


Alignment Length:265 Identity:49/265 - (18%)
Similarity:87/265 - (32%) Gaps:90/265 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 WTQIKQDIRRHW----DSLTPGDKMFAPILLCNL------VAFAMWRVPALKSTMITYFTSNPAA 181
            | .:.:.:||.:    :.|.|  .:|  |:|.:|      :.:|:|:......|:.|....:|..
Mouse    51 W-MLPEPVRRTYLERANCLPP--PLF--IILISLAELAVFIYYAVWKPQKQWITLDTGILESPLT 110

  Fly   182 -----KVVCWPMFLSTFSHYSAMHLFANMY----------VMHSFANAAAVSLGKEQFLAVYLSA 231
                 :...|........|....|:..|:.          ::|.......|.|.  ..||..|::
Mouse   111 YCPEKREEAWRFISYMLVHAGVQHIVGNLLMQIVLGIPLEMVHKGLRVGLVYLA--GVLAGSLAS 173

  Fly   232 GVFSSLMSVLYKAATSQAGMSLGASGAIMTLLA----YVCTQYPDTQLSILFLPALTFSAGAGIK 292
            .:|..|.|:            :||||.:..|:.    .|...:.:      .:||...     ::
Mouse   174 SIFDPLKSL------------VGASGGVYALMGGYFMNVIVNFRE------MIPAFGI-----VR 215

  Fly   293 VLMGIDFAGVVMGW----KFF--------DHAAHLGGAMFGI-------------------FWAT 326
            :|:.|......||:    :||        ..|||:.|...|:                   ||..
Mouse   216 LLVIILIVASDMGFALYRRFFVPANGSPVSFAAHIAGGFAGMSIGYTVFSCFDKTLLKDPRFWIA 280

  Fly   327 YGAQI 331
            ..|.:
Mouse   281 IAAYV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 34/185 (18%)
Rhbdl2NP_898986.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
Rhomboid 115..264 CDD:366759 32/173 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.