Sequence 1: | NP_001286324.1 | Gene: | rho-7 / 36281 | FlyBaseID: | FBgn0033672 | Length: | 351 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_030101763.1 | Gene: | Rhbdf2 / 217344 | MGIID: | 2442473 | Length: | 853 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 34/205 - (16%) |
---|---|---|---|
Similarity: | 63/205 - (30%) | Gaps: | 68/205 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 LCNLVAFAMWRVPALKSTMITYFTSNPAAKVVCWPMFLSTFSHYSAMHLFANMYVMHSFANAAAV 217
Fly 218 SLGKEQFLAVYLSAGVFSSLMSVL---YKAATSQAGMSLGASGAI-------------------- 259
Fly 260 ---MTLLAYVCTQYP-------------DTQLSILFLPALTFSAG----------AGIKVLMGID 298
Fly 299 FAGVVMGWKF 308 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
rho-7 | NP_001286324.1 | Rhomboid | 186..327 | CDD:396315 | 29/172 (17%) |
Rhbdf2 | XP_030101763.1 | Rhomboid_SP | 98..328 | CDD:372211 | |
Rhomboid | 648..788 | CDD:366759 | 21/139 (15%) | ||
MFS | 746..>836 | CDD:391944 | 15/78 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0705 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |