DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and Rhbdf2

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:XP_030101763.1 Gene:Rhbdf2 / 217344 MGIID:2442473 Length:853 Species:Mus musculus


Alignment Length:205 Identity:34/205 - (16%)
Similarity:63/205 - (30%) Gaps:68/205 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 LCNLVAFAMWRVPALKSTMITYFTSNPAAKVVCWPMFLSTFSHYSAMHLFANMYVMHSFANAAAV 217
            :|.|:.|.                 ||......:.::||.|.|...:|...::....:.......
Mouse   636 VCGLLPFL-----------------NPEVPDQFYRIWLSLFLHAGIVHCLVSVVFQMTILRDLEK 683

  Fly   218 SLGKEQFLAVYLSAGVFSSLMSVL---YKAATSQAGMSLGASGAI-------------------- 259
            ..|..:...:::.:|:..:|.|.:   |:|....||...|....:                    
Mouse   684 LAGWHRISIIFILSGITGNLASAIFLPYRAEVGPAGSQFGLLACLFVELFQSWQLLERPWKAFFN 748

  Fly   260 ---MTLLAYVCTQYP-------------DTQLSILFLPALTFSAG----------AGIKVLMGID 298
               :.|..::|...|             ...|:..|||.:||...          ..:.|..|: 
Mouse   749 LSAIVLFLFICGLLPWIDNIAHIFGFLSGMLLAFAFLPYITFGTSDKYRKRALILVSLLVFAGL- 812

  Fly   299 FAGVVMGWKF 308
            ||.:|: |.:
Mouse   813 FASLVL-WLY 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 29/172 (17%)
Rhbdf2XP_030101763.1 Rhomboid_SP 98..328 CDD:372211
Rhomboid 648..788 CDD:366759 21/139 (15%)
MFS 746..>836 CDD:391944 15/78 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.