DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment rho-7 and Rhbdl1

DIOPT Version :9

Sequence 1:NP_001286324.1 Gene:rho-7 / 36281 FlyBaseID:FBgn0033672 Length:351 Species:Drosophila melanogaster
Sequence 2:NP_659065.1 Gene:Rhbdl1 / 214951 MGIID:2384891 Length:373 Species:Mus musculus


Alignment Length:263 Identity:52/263 - (19%)
Similarity:82/263 - (31%) Gaps:73/263 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 DIRRHW----DSLTPGDKMFAPILLCNLVAFAMWRVPALKSTMITY--------FTSNPAAKVVC 185
            ::.|.|    ....|.....|.:.|..::.|..:.....|..:.||        ...:|..:...
Mouse   116 EVDRRWYFYRHRTCPPPVFMASVTLAQIIVFLCYGARLNKWVLQTYHPEYMKSPLVYHPGHRARA 180

  Fly   186 WPMFLSTFSHYSAMHLFAN----------------------MYVMHSFANAAAVSLGKEQFLAVY 228
            |......|.|.....|..|                      :|:....|.:..||:...:...|.
Mouse   181 WRFLTYMFMHVGLEQLGFNALLQLMIGVPLEMVHGVLRISLLYLAGVLAGSLTVSITDMRAPVVG 245

  Fly   229 LSAGVFSSLMSVLYKAATSQAGMSLGASGAIMTLLAYVC-TQYPDTQLSILFLPALTFS------ 286
            .|.||::...:.|.....:.|||..... .:..:||.|| :......:.:.|.|.|..|      
Mouse   246 GSGGVYALCSAHLANVVMNWAGMRCPYK-LLRMVLALVCMSSEVGRAVWLRFSPPLPASGPQPSF 309

  Fly   287 ----AGAGIKVLMGI-----------DFAG---VVMGWKFFDHAAHLGGAMFGIFWATY-----G 328
                |||.:.|.||:           |..|   |::.:..|        .:|.|||..:     |
Mouse   310 MAHLAGAVVGVSMGLTILRSYEERLRDQCGWWVVLLAYGTF--------LLFAIFWNVFAYDLLG 366

  Fly   329 AQI 331
            |.|
Mouse   367 ADI 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
rho-7NP_001286324.1 Rhomboid 186..327 CDD:396315 39/187 (21%)
Rhbdl1NP_659065.1 Rhomboid 174..328 CDD:279958 32/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0705
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.